Details for Chinese cabbage Locus Brara.E03210

Position : A05 ( 5`- 26118657 .. 26119671 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03210

Protein [Map View]
MASHSSLLIVLAVACFVSLISPAVSQTCSTQNILTTQKTPFQTCLDLPVLDSYLHYTYNATNSSLSIAFVATPARPSGWV
AWAINPTGTGMAGSQAFVALRSGPGVAPVVKTYNISSYNSLVEGKLAFDFWDLRTEALTGNRVVIHTSVKVPAGEDSVNQ
VWQIGGNVTNGRIGIHPFTPSNLKSTAVLRFSGSDPPASAPGGGASTTPGQAGGPGNAGSMTTRVNFGVSLGVLVLLGSI
FIL*

DNA
ATGGCTTCACATTCCTCTCTTCTTATTGTCTTAGCCGTTGCTTGTTTCGTTTCTCTCATCTCACCGGCGGTTTCACAAAC
TTGCTCTACACAGAACATACTCACCACCCAGAAAACTCCCTTTCAGACTTGCCTAGACCTTCCCGTACTCGACTCCTACC
TCCACTACACTTACAATGCAACCAACTCATCTCTCTCCATCGCCTTCGTCGCCACTCCAGCTAGACCCAGCGGCTGGGTC
GCTTGGGCTATCAACCCCACTGGGACTGGAATGGCCGGGTCTCAAGCCTTTGTAGCACTCAGATCCGGACCCGGTGTGGC
TCCCGTCGTGAAGACGTACAACATCAGTAGCTACAATAGTCTCGTCGAAGGAAAACTCGCCTTCGACTTTTGGGATCTAC
GAACCGAAGCCTTGACCGGGAACAGAGTCGTGATTCACACGTCGGTTAAGGTTCCGGCGGGAGAGGATAGCGTGAACCAG
GTGTGGCAGATCGGCGGGAATGTGACCAACGGCCGTATTGGAATTCATCCTTTTACTCCGTCAAATTTGAAATCTACAGC
CGTGCTGAGATTTAGTGGCTCTGACCCTCCCGCCTCTGCTCCGGGAGGTGGCGCCTCGACCACTCCCGGACAGGCGGGAG
GTCCAGGGAACGCAGGTTCTATGACGACACGTGTAAACTTTGGGGTCAGTTTGGGAGTTTTGGTTTTGTTGGGTAGTATA
TTTATTTTGTGA