Details for Chinese cabbage Locus Brara.E03207

Position : A05 ( 5`- 26103226 .. 26106058 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03207

Protein [Map View]
MDSHGKTHHEDASPNLIPLSKYSNRVELKTLLEQSDGGAGFLGKRVVVGGWVKSSRAVKKESLPPPPPEVFPPPPSSGGS
QASPTPSVSCTEIINSRMNIFRKLFDVLSGGGKTYPIFEKHDLAGQKATSPPEYIIHFQINDGSYVSTLQVIVDSVLSSV
PATQLMALGTCIVAEGVLRQPLSASAKHVIELEAEKLLHVGTVDPDKYPLSKKQLPLHMLRDHSHFRPRTTTVGSVTRVH
SALTLASHTFLQNNGFQYVQVPVITTTGAGEMFRVTTLLGEDDDKEEKKHVNEKDGFSIDTVKAAVKEKTRLIDHLKRSD
SNREAVVAAVYDLKKTSDLASQLEMKQRPKASATLIKPEKIDFSKDFFGCEAYLTVSGRLHLESYASALGKVYTFGPRFI
ADKIDSTRHLAEMWNVETEIAFSDLDDAMDCAAEFFKFLCKYLLENRHEDMKFISKRVDKTITIRLEATASSSILRFSYT
EAISVLQKATTRTFETKPDWGVALTEEHLSYLTDEIYKGCVIIHSYPKEVKPFYTRLNDDKKTVAAFDLVVPKVGVVITG
SQNEERFEILNARIREYGMTTREKYEWYLDLRRHGTVKHSGISLRMEHMLLFATGLPDIKDTVPFPRSWGKANN*

DNA
ATGGATTCTCACGGAAAAACCCATCATGAAGACGCCTCTCCGAATCTCATTCCCTTGTCAAAGTACTCGAACCGAGTCGA
GTTAAAGACTCTCCTCGAACAGAGCGACGGCGGCGCTGGTTTTCTCGGGAAAAGGGTTGTCGTCGGTGGATGGGTGAAGT
CCTCTAGAGCCGTAAAGAAAGAATCTTTACCCCCGCCGCCGCCGGAAGTTTTCCCCCCTCCGCCGTCGAGCGGCGGGAGT
CAGGCTTCTCCGACGCCCAGCGTTAGCTGCACGGAGATAATCAACTCGAGGATGAACATTTTCAGAAAACTTTTCGATGT
CTTGAGCGGCGGCGGAAAGACTTACCCAATATTCGAGAAACACGACCTCGCCGGTCAGAAGGCCACGTCACCACCTGAGT
ATATAATTCACTTCCAGATCAATGATGGCTCCTACGTTTCCACTCTCCAGGTTATTGTTGATTCTGTGTTGTCGAGTGTT
CCAGCAACTCAGCTTATGGCTCTAGGGACATGTATTGTAGCAGAAGGTGTGTTGAGACAACCATTGTCTGCTTCTGCAAA
ACACGTTATTGAGCTTGAGGCAGAGAAGCTTCTTCATGTAGGAACTGTGGATCCAGACAAGTATCCACTCTCAAAGAAAC
AGCTTCCTCTGCATATGCTTAGAGACCACTCTCATTTCAGGCCCCGCACGACTACGGTTGGGTCGGTGACTCGGGTCCAC
AGTGCATTAACTTTAGCGAGCCACACGTTTCTTCAAAACAACGGGTTTCAGTATGTCCAAGTACCAGTCATCACAACCAC
TGGAGCTGGCGAGATGTTTAGAGTCACTACTCTTTTAGGTGAAGATGATGATAAAGAGGAGAAGAAACATGTCAATGAAA
AAGATGGATTTAGCATTGACACAGTAAAGGCTGCGGTAAAGGAGAAGACTAGGCTAATTGACCACCTTAAGAGATCTGAC
AGCAATCGAGAAGCTGTGGTTGCTGCGGTATACGACTTGAAGAAAACGAGCGATCTTGCATCTCAGCTTGAGATGAAACA
AAGACCAAAGGCATCAGCAACTCTGATCAAACCAGAGAAGATTGATTTCTCGAAAGATTTCTTTGGTTGTGAGGCTTATC
TGACTGTGTCTGGGAGGCTTCATCTTGAGAGCTATGCTTCTGCACTTGGAAAAGTCTATACCTTTGGACCGAGATTCATA
GCTGATAAAATCGACAGTACAAGGCATTTGGCGGAGATGTGGAATGTGGAGACTGAGATTGCTTTCTCTGACTTAGATGA
TGCTATGGATTGTGCTGCTGAATTCTTCAAGTTCCTGTGCAAGTATCTTCTGGAAAATCGTCACGAAGACATGAAATTCA
TATCTAAACGAGTAGATAAGACCATCACCATACGTCTTGAAGCAACAGCGTCTAGTTCTATTTTGAGGTTCTCTTATACT
GAAGCGATTAGTGTTCTACAAAAGGCAACCACTAGAACATTCGAAACCAAGCCTGACTGGGGCGTTGCTTTAACAGAGGA
GCATCTCAGTTACCTAACTGATGAGATCTACAAGGGTTGTGTAATTATACATAGCTACCCGAAAGAGGTTAAACCGTTTT
ACACACGGTTGAATGATGATAAGAAGACTGTAGCAGCATTTGATCTGGTCGTACCAAAGGTTGGTGTTGTGATCACTGGG
AGCCAAAACGAAGAGCGGTTTGAGATCTTGAATGCGAGGATAAGAGAATATGGAATGACAACAAGGGAGAAGTACGAGTG
GTACTTGGATTTAAGGAGGCATGGGACAGTGAAGCATTCAGGAATAAGCCTAAGGATGGAGCATATGCTTCTGTTTGCGA
CAGGGCTTCCTGATATCAAAGACACAGTTCCTTTCCCAAGAAGTTGGGGCAAAGCAAACAACTAA