Details for Chinese cabbage Locus Brara.E03206

Position : A05 ( 5`- 26101702 .. 26101998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03206

Protein [Map View]
MVRRNAVHATSSLPSRLWWPQQRRKGKRAVVRLGNRRRGFLVGQPRTVVQRWRINIGKPMKMMRNIILGMISNGGNVKFL
DAYLWSLPILRPQLFPLC*

DNA
ATGGTAAGAAGAAACGCAGTTCATGCCACTTCAAGTCTTCCCTCTAGGCTTTGGTGGCCGCAGCAACGGAGGAAAGGAAA
AAGGGCCGTCGTTAGATTAGGAAACCGGCGACGAGGGTTCTTGGTGGGACAACCGCGGACGGTGGTGCAGAGATGGAGGA
TCAACATCGGAAAGCCGATGAAAATGATGAGAAATATCATTTTGGGAATGATCTCAAATGGTGGAAATGTTAAGTTCTTA
GATGCTTATCTTTGGTCTTTACCTATTTTACGTCCTCAGTTGTTTCCACTATGCTGA