Details for Chinese cabbage Locus Brara.E03205

Position : A05 ( 5`- 26100958 .. 26101419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03205

Protein [Map View]
MNNSHVLKTVILIMVLVESGLVEEATAHPCGRTFLSALIQLVPCRPSVAPFSTLSPNGLCCAAIKRLGQPCLCALSKGPP
ISGVDRALSLQLPGKCSANFPPCN*

DNA
ATGAATAACTCACACGTTCTTAAAACAGTCATATTGATTATGGTTTTGGTCGAGTCAGGCCTGGTCGAAGAGGCTACCGC
GCACCCATGTGGTCGAACATTTTTGTCGGCTTTGATTCAACTCGTGCCGTGTAGACCATCAGTCGCGCCGTTTAGCACAT
TGTCTCCGAACGGGCTATGTTGCGCTGCCATCAAGAGGCTTGGTCAACCTTGTCTATGTGCTCTTTCCAAGGGACCACCT
ATATCTGGCGTTGACCGCGCTCTCTCTCTCCAGTTACCTGGAAAATGTTCTGCTAATTTTCCTCCGTGTAACTAA