Details for Chinese cabbage Locus Brara.E03204

Position : A05 ( 5`- 26098446 .. 26099683 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03204

Protein [Map View]
MIPILQISILCFFLFAGISISSSSEEEETIYKILQDNGLPSGIFPKGVTEFTFDGETGRFSVYLNHSCDAKYETELRYDT
NITGTLSSANVTDLSGISAQDLFLWFPVKGIRVDVPSSGLIYFDVGVVRKQYSLSVFETPRDCVAVRRENEVESSVLSLH
QVDETLGRNVI*

DNA
ATGATTCCTATCCTCCAAATCTCGATCCTTTGTTTCTTCCTCTTCGCCGGGATCTCGATCTCCTCCTCCTCAGAGGAGGA
AGAGACTATATACAAGATCCTCCAGGACAACGGCCTCCCGTCGGGGATTTTCCCGAAAGGCGTGACGGAGTTCACCTTCG
ACGGCGAGACGGGACGGTTCTCCGTTTACTTGAACCACTCCTGCGATGCTAAGTACGAGACGGAGCTTCGCTACGACACG
AACATCACGGGGACGCTGAGCTCTGCTAACGTGACTGATTTGTCGGGAATCTCGGCTCAGGATCTGTTCCTGTGGTTTCC
GGTTAAAGGGATACGTGTCGATGTCCCGAGCTCGGGGCTTATATACTTCGATGTTGGTGTTGTTCGGAAGCAGTACTCGT
TGTCTGTGTTCGAGACGCCCAGAGATTGCGTCGCGGTTCGGCGTGAGAATGAGGTTGAATCTTCTGTGTTGTCATTGCAT
CAAGTAGATGAAACTCTTGGGAGAAACGTTATTTAG