Details for Chinese cabbage Locus Brara.E03202

Position : A05 ( 5`- 26094104 .. 26094565 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03202

Protein [Map View]
MDQTELSRIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEFGGLYQSIMDDRDEEEDII
EAFNVFDQNRDGFITVEELRSVLSSLGLKQGRTLEDCKRMISKVDVDGDGMVNFKEFKQMMKGGGFAALESSL*

DNA
ATGGATCAAACAGAGCTTTCCCGGATATTCCAAATGTTCGACAGGAACGGTGACGGCAAAATCACCAAACAAGAGCTGAA
CGATTCGTTAGAGAATCTCGGAATCTACATCCCGGACAAAGACTTGGTGCAGATGATCGAGAAGATTGATCTCAACGGTG
ACGGGTACGTGGACATCGAAGAGTTTGGAGGGCTGTACCAGTCGATCATGGACGATAGAGACGAGGAGGAAGACATCATA
GAGGCGTTCAACGTGTTTGATCAGAACCGTGACGGGTTCATCACGGTGGAAGAGCTGAGATCTGTCTTATCTTCCTTGGG
GCTCAAGCAAGGAAGAACGCTAGAGGATTGCAAGAGGATGATAAGCAAAGTGGATGTTGATGGAGATGGGATGGTGAATT
TTAAAGAGTTTAAGCAAATGATGAAAGGTGGTGGATTTGCTGCCTTAGAATCAAGCTTGTAA