Details for Chinese cabbage Locus Brara.E03195

Position : A05 ( 5`- 26077870 .. 26079568 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03195

Protein [Map View]
MASSQPSGGRPPKPWEQEGNNNAAGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAPTMNGLSRPVPTRPWEQQ
NYGSTYGSNLGMNAGYGSGIGGYGSSYGGGMYGGSRMYNRGGYGGGGGLYGSSGMYGGSFGGGYGMGMGTGMGMGMGMGM
SPYGGQDPNDPFNQPPSPPGFWISFLHVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGMLYGELARFVLRMLG
VRTKPRKMQQQPQGPNGLPLPHQPHGNQNYLEGPKAAAAPGGGGWDNVWGN*

DNA
ATGGCTTCGTCTCAGCCATCAGGTGGGCGTCCTCCTAAGCCTTGGGAGCAAGAAGGGAACAACAACGCAGCTGGTCCTAA
GCCTTTCAGGCCTCCTTCTAATACGAGCACTGCTGATTCAGTTGAGGCTTCTGGCACTGCGAATCCTGGTGAACTAGTTT
CGTCTGTGAATAGGACTAACACAGCTCCTACTATGAATGGACTGAGTAGACCTGTTCCAACTAGACCTTGGGAGCAGCAG
AACTATGGAAGCACTTATGGTTCAAACCTAGGTATGAACGCTGGGTATGGTTCAGGGATAGGTGGGTATGGTTCGTCATA
TGGGGGAGGAATGTATGGTGGTAGTCGGATGTATAATAGAGGAGGTTATGGTGGTGGTGGTGGTCTCTATGGAAGCTCAG
GTATGTATGGGGGCAGTTTTGGTGGTGGTTATGGTATGGGTATGGGGACAGGAATGGGGATGGGGATGGGCATGGGAATG
AGTCCTTATGGTGGTCAAGATCCAAATGACCCTTTTAATCAACCTCCATCTCCACCAGGCTTCTGGATATCTTTTCTCCA
TGTGATGCAAGGTGCTGTGAATTTCTTTGGCCGTGTAGCGATGCTGATTGACCAAAACACACAGGCCTTTCATATGTTCA
TGTCTGCCCTTCTTCAGCTCTTTGATCGTGGTGGTATGTTATATGGAGAATTAGCAAGATTTGTACTGCGTATGCTTGGT
GTGAGAACAAAGCCTAGAAAGATGCAGCAGCAGCCACAAGGGCCTAATGGACTCCCTTTACCCCACCAGCCACATGGAAA
CCAGAACTACCTCGAAGGTCCTAAAGCTGCCGCTGCACCAGGTGGTGGTGGTTGGGACAATGTATGGGGTAACTAA