Details for Chinese cabbage Locus Brara.E03194

Position : A05 ( 5`- 26075562 .. 26077709 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03194

Protein [Map View]
MAASANPSGNNQEGSSAAAQKVSSSSAAAAATNGAAVNSVDNGGTVDNSQTISALRHNPGISVDWTHEEQSLLEDLLAKY
ASEPTIVRYAKIAMKMKDKTVRDVALRCRWMTKKENGKRRKEDHSSRKSKDKKEKTTDTSAKASSHLNVHPNGPSYAPPM
MPLDTDDGISYKAIGGVSGDLLEQNAQMFNQVSSNFSAFQIHDNVNILCKARDNILAILNDLNDMPEVMKQMPALPVKLN
EELANSILPRPPPPHQRKP*

DNA
ATGGCGGCGAGCGCGAATCCCTCGGGAAACAATCAGGAAGGTTCGTCGGCGGCGGCGCAGAAGGTATCGTCTTCATCCGC
GGCGGCGGCGGCGACGAACGGAGCTGCTGTGAATTCGGTGGATAATGGTGGGACGGTGGATAATTCGCAGACGATAAGCG
CGTTGAGGCATAATCCAGGGATCTCTGTAGATTGGACTCACGAGGAGCAATCGTTATTGGAAGATTTGCTCGCAAAGTAC
GCGTCAGAGCCTACGATTGTTAGGTATGCGAAGATTGCTATGAAGATGAAGGATAAGACTGTTAGAGATGTTGCTCTTCG
TTGTAGATGGATGACTAAGAAGGAGAACGGTAAGCGTAGGAAAGAAGACCATTCCTCAAGGAAGAGCAAAGATAAGAAAG
AAAAAACTACGGATACTTCAGCCAAGGCCTCGTCTCATTTAAATGTGCATCCGAATGGTCCTTCATATGCTCCTCCTATG
ATGCCTTTAGATACCGATGACGGCATTTCATATAAAGCTATTGGTGGTGTGAGTGGAGATCTTCTTGAACAAAATGCTCA
GATGTTCAACCAAGTTTCTTCAAATTTCTCAGCTTTCCAGATACATGATAACGTCAATATCTTGTGCAAGGCTCGAGACA
ATATCCTCGCAATATTGAACGACTTGAATGACATGCCAGAGGTCATGAAGCAGATGCCAGCTCTTCCTGTGAAGCTGAAC
GAAGAGCTGGCGAATTCAATCCTCCCCCGCCCTCCACCTCCCCATCAAAGGAAGCCGTGA