Details for Chinese cabbage Locus Brara.E03191

Position : A05 ( 5`- 26069497 .. 26071171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03191

Protein [Map View]
MADPSSNTKKYTPPGLRNPSGSNKKTGGSQQNKDGERSQPQMEKASGKIVTLKDCATSEAYQLLSERWAAAMHQYNDPTV
DLSERPVMHYGGSVWGKLPHQILASANNTLPPKITPADYRAELRRGLLTPRSSSN*

DNA
ATGGCGGATCCGAGCTCCAACACGAAGAAGTACACTCCCCCTGGTCTAAGGAATCCTTCTGGGAGTAACAAGAAGACAGG
AGGTAGCCAGCAGAACAAGGATGGTGAGAGAAGTCAGCCTCAGATGGAGAAAGCTTCCGGAAAGATAGTCACTCTAAAGG
ACTGCGCTACGAGTGAAGCTTATCAGCTTTTAAGCGAACGCTGGGCAGCTGCAATGCATCAATACAACGACCCAACCGTG
GATTTATCTGAACGACCAGTCATGCACTATGGAGGGAGTGTTTGGGGTAAACTACCTCACCAGATCCTGGCTTCAGCAAA
CAATACATTGCCTCCAAAGATAACGCCAGCGGATTACAGAGCTGAACTGCGCCGAGGATTGCTGACTCCAAGAAGTTCTA
GCAACTGA