Details for Chinese cabbage Locus Brara.E03190

Position : A05 ( 5`- 26068218 .. 26069208 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03190

Protein [Map View]
MKLVRFLMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLKTVKMTLKGKNPVTMDHLSLRGNNIRYYILPDSLNLETLL
VEDTPRVKPKKPVAGKPVGRGRGRGGRGRGGAGRGRGR*

DNA
ATGAAGCTCGTCAGGTTTTTGATGAAGCTGAACAATGAAACTGTGTCGATCGAGCTGAAGAACGGGACTGTGGTCCATGG
AACCATCACTGGTGTTGATGTGAGCATGAATACTCACTTGAAGACTGTTAAAATGACTCTCAAGGGGAAGAACCCGGTGA
CAATGGACCATCTAAGCTTGAGGGGTAACAACATCCGCTACTACATTCTTCCTGATAGCTTGAACCTCGAGACTTTGCTT
GTGGAAGACACTCCTCGAGTCAAGCCTAAGAAGCCTGTTGCTGGGAAGCCTGTTGGACGAGGCCGTGGACGTGGTGGTCG
TGGGCGTGGTGGTGCTGGTCGTGGCAGAGGTCGTTAA