Details for Chinese cabbage Locus Brara.E03189

Position : A05 ( 5`- 26067270 .. 26068098 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03189

Protein [Map View]
MSIKQKILIRVTMTDDKTRAKAMKTAAQFKGVSAVEIKGDHRNQIEVTGVEVNMICLTNTLRKKVAFAELVSVNKVEPPK
KEDDKKKECKKPDEKKPDEKKADEKKTDEKKPEPCCCNPCYQPWPYGYGVPSSFPHPCDPYGYNFRDYTGEPFYNYGPNW
RFM*

DNA
ATGAGCATCAAGCAAAAGATCCTGATAAGAGTTACTATGACTGATGATAAAACCAGAGCAAAAGCAATGAAAACTGCCGC
TCAGTTTAAAGGAGTCTCGGCTGTGGAAATAAAGGGAGATCACAGGAACCAGATTGAGGTGACCGGTGTTGAAGTCAATA
TGATCTGTCTAACCAACACACTGAGGAAGAAGGTAGCCTTCGCTGAGCTTGTAAGCGTAAACAAAGTTGAACCACCCAAG
AAAGAGGACGACAAGAAGAAGGAATGCAAGAAACCCGATGAAAAGAAACCTGATGAGAAGAAAGCCGACGAGAAAAAAAC
AGATGAGAAAAAGCCAGAGCCATGTTGTTGTAACCCATGTTATCAACCATGGCCTTACGGATATGGTGTGCCATCTTCCT
TTCCACATCCGTGTGATCCCTACGGGTATAACTTTAGAGATTATACTGGGGAACCTTTCTACAACTACGGACCCAATTGG
AGGTTCATGTGA