Details for Chinese cabbage Locus Brara.E03188

Position : A05 ( 5`- 26054449 .. 26061740 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03188

Protein [Map View]
MSSTEEEAIRVVADEEQNPRAVRIRAPRACTLSTVDYAEPPIDDDDDESKPKAKRGRPRKSPEEDQTTSGTPKAKPGRPR
KIPEEVDDKPIRPRKNPEEDEKTNGTLKAKPGSPRKEDQTTNDTPKAKPGRPRKNPEEDEKVNGTPKAKRGRPRKNPQED
GNTDDKPKAKPGKQEDQKTSDKPKAKPDRPRKNAEDDEKTNDTPKAKPGRPPKYPVNEEDEKSTKKVDQGVIACLERKEN
GAEEIIKASDGMPRFKKVYSRKRPLKEDEDEKKDDELVSKGSVKVTKRPRKVVVGCLNKDEDKAEESECMMCHQCQRNDN
GEVVRCQNCCDRKRYCHKCLETWYPRIPHEDIAKKCPFCWNTCNCRACLRLDTKMEGLNSDLKVSKDEEVQCSKYILQKL
LPHLKEINDEQVLEKEAEANISGLEFGEVKPEDTNCSPGERLYCDSCQTAIFDLHRHCSSCGSDICIACSMEIRKGKLQA
CQEDVYWNYISRGLDYLHGGKEKNGKHTDDKLEPEPLLAIVKPPSTWKTDEVGLITCCCGEGILELKRVLPDGWVSELVK
KVEETVEANKLFDLPEMATERCPCFDSEGHIDMDTNKNVLKAACREGSEDNFLYFPSATDAQKEINLKHFQHHWAKGEPV
IVRNVLEATAGLSWEPGVMHRACRQMRSTKHETLLDVNAIDCLDCCEGSINLHAFFTGYQKGRYDREGWPSVLKLKDWPP
SKSFNENLPRHCEEFLCSLPLKQYTHPVSGPLNLAVKLPDFCLKPDMGPKTYVAYGFAQEMGRGDSVTKLHCDMSDAVNV
LTHVSEVTIKEEEKKSTIEKLKRKHAAQDVKELFGSVPNYKEKIEILENTNEEEVKNLEADGGALWDIFRREDVPKLEKY
LLSHHKKFRHFFCSPVSKVVHPIHDQSFYLTRYHKMILKEEYGIEPWTFVQKLGDAVLIPVGCPHQVRNLKSCTKVALDF
VSPENISECFRLTKEYRLLPPNHHSKEDKLQIKNMVIFAIDKALEDLHPNYKSPVAKEEEKKVTKGGRKRKNREMSNGAN
VLA*

DNA
ATGAGTTCTACAGAGGAGGAAGCTATTAGGGTTGTTGCTGATGAAGAACAGAATCCACGAGCTGTTCGGATTAGGGCGCC
GAGAGCTTGTACGTTATCAACGGTTGATTACGCCGAGCCTCCGATTGACGACGATGACGACGAAAGCAAGCCAAAGGCGA
AACGAGGCAGGCCTCGTAAAAGCCCTGAAGAAGACCAAACGACGAGTGGTACACCAAAGGCTAAACCGGGTAGGCCTCGG
AAGATTCCTGAAGAAGTTGATGATAAACCGATCAGGCCTCGTAAAAATCCGGAAGAAGACGAGAAGACGAATGGTACACT
AAAGGCTAAACCGGGCAGTCCTCGGAAAGAAGACCAGACGACGAATGATACACCCAAGGCTAAACCGGGAAGGCCTCGGA
AAAATCCTGAAGAAGACGAGAAGGTGAATGGTACACCAAAGGCTAAACGAGGCAGGCCTCGGAAAAATCCTCAAGAAGAC
GGGAATACAGATGATAAACCGAAGGCTAAACCGGGGAAGCAAGAAGATCAGAAGACGAGTGATAAACCGAAGGCTAAACC
GGACAGGCCTCGGAAAAATGCTGAAGACGACGAGAAGACTAATGATACACCGAAGGCTAAACCGGGAAGGCCTCCGAAGT
ATCCTGTCAACGAAGAAGACGAAAAGTCAACGAAGAAAGTTGACCAAGGTGTTATCGCTTGTTTAGAGAGGAAGGAGAAT
GGAGCTGAAGAGATTATTAAGGCTTCTGATGGAATGCCAAGGTTCAAGAAGGTTTATTCTCGTAAAAGGCCATTGAAAGA
AGACGAAGACGAGAAGAAGGATGATGAACTTGTTTCTAAAGGCTCTGTTAAGGTTACTAAGAGGCCTCGGAAAGTGGTGG
TAGGTTGTCTCAACAAAGACGAGGATAAAGCTGAAGAATCTGAGTGCATGATGTGTCATCAGTGTCAACGTAACGATAAT
GGGGAGGTTGTGCGGTGTCAGAACTGCTGCGATAGGAAGCGTTATTGCCACAAATGCTTAGAAACTTGGTACCCTCGCAT
CCCACATGAAGACATTGCCAAGAAATGCCCGTTTTGCTGGAATACTTGCAACTGCAGAGCATGCTTGCGTCTAGATACTA
AAATGGAAGGGTTAAATTCAGACCTCAAGGTTAGCAAGGATGAAGAAGTCCAATGCTCTAAGTATATTCTGCAAAAGCTT
CTCCCACATCTGAAGGAAATAAACGATGAACAAGTTCTTGAGAAGGAAGCTGAGGCAAATATATCAGGACTGGAGTTTGG
AGAGGTGAAGCCTGAAGACACTAATTGTAGCCCTGGCGAAAGACTATACTGTGATAGCTGCCAGACTGCGATCTTTGACC
TTCATAGACATTGCTCGAGCTGCGGTTCTGATATCTGCATTGCATGTTCCATGGAGATCCGAAAAGGAAAGCTTCAGGCA
TGTCAGGAGGATGTTTACTGGAATTACATTAGCAGAGGTTTAGATTATCTACATGGAGGAAAAGAAAAAAATGGTAAACA
TACGGATGATAAGCTGGAGCCGGAACCATTACTTGCTATTGTCAAGCCCCCATCTACTTGGAAAACAGATGAAGTCGGAC
TCATTACTTGCTGTTGTGGTGAGGGGATTTTAGAGTTGAAACGCGTGCTTCCCGATGGTTGGGTATCAGAATTGGTCAAA
AAGGTTGAAGAAACTGTTGAAGCCAACAAGCTTTTTGATTTACCTGAAATGGCCACAGAGAGATGCCCTTGTTTTGACTC
TGAAGGTCATATTGACATGGACACCAACAAAAACGTGTTAAAGGCTGCATGTCGAGAAGGATCAGAAGACAATTTTCTAT
ATTTTCCGAGTGCTACAGATGCTCAGAAGGAGATTAATCTGAAGCATTTTCAGCATCATTGGGCAAAAGGAGAGCCTGTG
ATTGTGAGGAACGTGCTTGAGGCTACAGCTGGTTTAAGCTGGGAACCAGGTGTTATGCATCGTGCTTGCCGTCAGATGAG
AAGCACCAAGCATGAAACACTTCTGGACGTTAATGCTATTGATTGTCTAGACTGCTGTGAGGGATCCATTAATCTTCATG
CATTCTTTACCGGTTACCAAAAAGGCCGTTATGATCGTGAGGGTTGGCCAAGTGTTCTGAAACTGAAAGATTGGCCTCCA
TCGAAGAGCTTCAATGAAAACTTGCCGCGTCACTGTGAGGAGTTCTTATGCAGTTTGCCTTTGAAGCAGTACACTCACCC
GGTTAGTGGGCCTTTAAATCTTGCCGTGAAGTTGCCTGATTTTTGCTTGAAACCGGACATGGGACCAAAGACTTACGTTG
CTTATGGATTTGCGCAAGAAATGGGCCGTGGAGATTCAGTAACCAAACTCCACTGCGACATGTCTGATGCGGTTAATGTG
CTGACCCACGTAAGTGAAGTGACCATCAAAGAGGAAGAAAAGAAATCCACAATAGAAAAACTGAAGAGGAAGCATGCTGC
ACAAGATGTCAAGGAGCTGTTTGGCTCGGTTCCTAACTACAAGGAAAAGATTGAGATTCTTGAAAACACTAATGAAGAAG
AAGTCAAGAACCTTGAAGCTGATGGAGGAGCTCTTTGGGACATTTTCCGTAGAGAAGATGTTCCAAAATTAGAGAAATAC
CTTCTGAGTCATCATAAAAAGTTTCGACATTTCTTCTGTTCCCCCGTCTCTAAGGTGGTTCATCCAATACATGACCAGTC
TTTCTATCTGACGCGTTATCATAAAATGATTCTGAAAGAAGAATACGGCATTGAGCCATGGACGTTTGTTCAGAAGCTTG
GAGATGCTGTGTTAATACCTGTAGGCTGCCCTCATCAAGTCAGGAACTTGAAGTCTTGCACAAAGGTGGCGCTTGACTTT
GTCTCACCTGAAAATATCAGTGAGTGTTTCCGCTTAACAAAGGAGTATCGTCTGCTACCACCAAACCATCATTCAAAAGA
GGACAAGTTGCAGATAAAGAATATGGTGATCTTTGCAATCGATAAGGCTCTCGAAGACTTGCATCCAAATTATAAGTCTC
CTGTAGCCAAAGAGGAAGAGAAGAAGGTGACGAAGGGGGGAAGGAAGCGTAAAAACCGTGAGATGAGTAATGGAGCTAAT
GTGTTGGCTTGA