Details for Chinese cabbage Locus Brara.E03186

Position : A05 ( 5`- 26031846 .. 26034586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03186

Protein [Map View]
MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNSQPATVRCVEERVSLCQNCDWSGHNNNN
NNSSSSSNNHKRQTISCYSGCPSSSELASIWSFCLDLAGQSGCEQEMGLMNIDDDGQNNQNCNEEKKDVAGSSSRPETSS
AAPATSSFPKDVRVCEDDFYGNLGMDEVDLALENYEELFGTAFNTSGELFGQGGIDCLFQKHHQGAAPEGGNLVQPAESN
DDSFMSSKTEPIICFTSKPAHSNISFSGVTGDSSAGDFQECGASSSMQLSGEPPWYPQTSQDNNASSHSVTRNNAVMRYK
EKKKARKFDKTVRYASRKARADVRRRVKGRFVKAGEAYDYDPLTPTRSY*

DNA
ATGGGTTACATGTGTGACTTCTGTGGTGAACAACGTTCAATGGTGTACTGTCGTTCAGACGCAGCCTGTCTCTGCCTCTC
CTGCGACAGGAGCGTCCACTCCGCTAACGCATTGTCCAAGCGACATTCTAGGACACTCGTCTGCGAGAGATGCAATTCTC
AGCCTGCAACAGTCAGGTGTGTTGAAGAAAGGGTTTCACTTTGTCAAAACTGTGATTGGTCTGGCCACAACAACAACAAT
AACAATTCTTCTTCCTCATCAAATAATCACAAGAGGCAAACCATAAGCTGCTATTCTGGTTGCCCTTCTAGCTCGGAGCT
CGCTTCTATATGGTCTTTCTGTTTGGACTTAGCTGGACAATCTGGTTGTGAACAAGAAATGGGGTTGATGAATATAGATG
ATGATGGTCAGAACAACCAAAACTGTAATGAGGAGAAGAAAGATGTCGCCGGCTCCTCCTCAAGGCCTGAAACCAGTTCT
GCAGCACCTGCAACTTCATCATTTCCCAAGGATGTTAGAGTATGTGAAGATGACTTTTATGGGAACTTGGGTATGGATGA
AGTTGACTTGGCTCTTGAGAACTATGAAGAGCTCTTTGGGACAGCCTTTAACACCTCTGGAGAGCTCTTTGGACAAGGTG
GCATCGATTGTCTTTTCCAGAAACATCACCAAGGAGCAGCTCCTGAGGGAGGGAATCTTGTACAGCCTGCTGAGAGCAAT
GATGATTCTTTCATGAGTTCAAAAACAGAACCAATCATTTGCTTCACATCGAAACCAGCACATTCCAACATATCATTCTC
TGGAGTCACAGGAGATAGTAGCGCTGGAGATTTTCAAGAATGTGGTGCATCGTCTTCAATGCAGCTCTCCGGTGAGCCAC
CATGGTATCCTCAAACATCACAGGATAACAATGCTTCCTCACATTCAGTGACCCGTAATAACGCGGTTATGCGTTACAAG
GAGAAAAAGAAGGCTCGCAAGTTTGATAAGACAGTGAGGTATGCTTCTCGCAAAGCAAGAGCTGATGTGAGACGGCGTGT
AAAGGGAAGATTTGTCAAAGCTGGTGAAGCTTATGACTATGACCCACTCACCCCAACCAGAAGCTATTGA