Details for Chinese cabbage Locus Brara.E03185

Position : A05 ( 5`- 26026715 .. 26031618 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03185

Protein [Map View]
MVGSGARVSIGADTRKTIQTIKEITAGNYSEDEIHAMLLDCSMNPDEAAQRLLLQDPFLEVKKKRDKRKENLSNKDSVEP
QWRSGGPGRGSRGGRMNFSSRHSSHDGAGAKNSFRKENSPKQVADPSTSTSQQQIKTKDNALVCSLPPVMDKSSVGLTSG
SPDGAPSAVESSKNRVALGSNAVHTEQKSANSLPLSRPSSSEVRFTSSNSKPVSEQHLGQSKLQNRSRGVGKATVNDAYV
PRPASSHSNSTGSRPSSNYSNRSHHTVGPQRVKEWKPKPVNHTTTQGSGASATTEALAVPTEASEKSVEDVVPSAEGTSK
LQRQLEDLQIQRQHVIIPNHILVPEAERTKFSFGSFDAGFSITSSSVAFPENEKRSAPLSQNSQEVENSLEEDELSHPNV
HSTEKDEENNVYSESPSQVPNDIAGEGITAANAASVYDVSKQENMLESESNQSPFDHVPSNITGPVPPAPGSQLPQFENA
DPQARDALRIPNFVVQQPFDTASYYAQFYRSGPDSDGRVSPFVSPGVASKFNGNVTVLPPHSSQTMQESGNNSVLSTASP
TPLVTQPAGLMQSSIPVTQQPVPFLRPPGLHMSHYPPNYMPYGHYFSPFYLPHPAMQQFLSNGAFAQQPQASSVYPPPPP
PGAATGGKYTFPHHKPGSNNTGNLTHVGTPGVYGSPSHGSFPAGYNPNSAASAVNSTSNEDLNTLQLKENNGYSTTGQQS
EALPVWIAGPGRDVPSSFYGLQHHGQHVTYAPAQAGHVTFPGMYHPGQAVTAAGGVHHPLLQQSQGVAGAEMVAPGPPNV
FPQPQQTPMNWPSNY*

DNA
ATGGTTGGGAGTGGTGCTAGGGTTTCGATTGGGGCGGATACGAGGAAGACGATTCAGACCATCAAGGAGATCACTGCTGG
GAACTACAGCGAGGATGAGATTCACGCAATGCTCCTTGATTGCAGTATGAATCCCGATGAGGCTGCTCAACGCCTTCTTC
TTCAGGATCCATTCCTTGAGGTTAAGAAGAAGCGTGATAAGAGAAAAGAGAACCTTAGCAACAAGGACTCTGTTGAGCCA
CAATGGAGATCTGGTGGTCCGGGCCGTGGTAGCAGGGGTGGTCGGATGAATTTTTCTTCTCGTCATTCATCACACGATGG
TGCTGGTGCAAAGAATTCTTTCAGAAAAGAAAATAGTCCAAAGCAGGTCGCTGATCCATCAACTTCGACCTCTCAACAAC
AAATAAAAACTAAAGACAATGCCTTGGTGTGTAGCCTTCCACCTGTGATGGATAAAAGTTCTGTTGGTTTGACATCAGGA
AGCCCTGACGGTGCACCCTCTGCTGTTGAATCAAGCAAAAATCGTGTAGCATTGGGCTCTAATGCTGTGCATACTGAGCA
GAAGTCGGCTAATTCTCTGCCACTCTCTCGTCCATCCTCCTCGGAGGTTCGATTCACTTCTTCAAATTCCAAACCAGTGA
GCGAGCAACACCTTGGACAAAGCAAGTTACAGAACAGATCCCGTGGGGTTGGGAAGGCTACCGTGAATGATGCTTATGTT
CCGAGGCCTGCTTCATCTCATAGCAACAGCACGGGTAGCCGGCCTTCTTCTAACTACAGTAATCGTTCGCATCACACTGT
TGGTCCTCAAAGAGTTAAGGAATGGAAACCGAAGCCAGTGAACCATACCACTACTCAGGGCTCTGGTGCATCAGCTACAA
CTGAAGCTCTTGCGGTTCCTACTGAAGCCAGTGAAAAATCTGTTGAAGATGTTGTTCCTTCTGCAGAGGGCACATCTAAG
TTGCAGAGGCAGCTTGAAGACTTGCAGATCCAACGCCAGCATGTTATTATCCCAAACCATATCCTTGTTCCAGAGGCTGA
ACGAACCAAGTTTAGCTTTGGAAGCTTTGATGCTGGCTTTTCTATAACATCAAGCTCAGTAGCTTTTCCAGAGAATGAAA
AGAGATCTGCACCTCTCTCTCAGAATTCACAGGAGGTTGAAAATAGTTTGGAAGAAGACGAACTTAGCCACCCAAATGTC
CATTCGACTGAAAAGGACGAGGAGAATAATGTTTACTCCGAGTCGCCTTCACAAGTTCCAAATGATATTGCTGGTGAAGG
TATCACCGCAGCAAACGCAGCTTCAGTGTATGATGTCTCCAAGCAAGAGAACATGTTAGAGTCCGAAAGCAATCAAAGCC
CTTTTGACCACGTTCCAAGTAACATTACCGGGCCTGTTCCTCCAGCTCCTGGGAGCCAGCTTCCACAGTTTGAGAATGCT
GATCCTCAAGCACGTGACGCCCTTCGTATTCCTAACTTTGTGGTCCAGCAACCATTTGATACAGCGAGTTACTATGCTCA
ATTCTACCGATCAGGCCCTGACAGTGATGGCCGTGTTTCTCCCTTTGTTTCTCCAGGGGTTGCATCCAAGTTTAATGGGA
ATGTTACAGTATTGCCCCCTCATTCATCTCAAACCATGCAAGAGAGTGGAAACAACTCAGTTCTGTCGACAGCTAGTCCA
ACTCCACTGGTAACACAGCCTGCTGGGCTGATGCAGAGCTCTATACCTGTCACGCAGCAGCCTGTTCCTTTCTTACGCCC
CCCAGGATTACACATGTCACATTATCCACCGAACTACATGCCATATGGACACTACTTCTCCCCATTCTATCTACCTCACC
CGGCAATGCAACAGTTCTTAAGCAATGGCGCGTTTGCTCAGCAGCCTCAGGCAAGCAGTGTGTATCCTCCTCCTCCACCC
CCTGGAGCTGCAACAGGTGGCAAATACACATTCCCTCATCACAAGCCTGGGAGTAATAATACAGGAAACTTGACTCATGT
TGGTACGCCTGGTGTTTACGGATCACCATCACATGGTTCCTTCCCAGCAGGATATAATCCCAATTCTGCTGCGTCAGCTG
TGAATTCAACTTCCAATGAGGATCTCAACACGTTGCAGTTGAAGGAAAACAACGGCTACAGCACAACAGGGCAACAGAGT
GAAGCTTTACCTGTATGGATTGCTGGACCAGGAAGAGATGTGCCGAGCTCGTTCTACGGTTTACAGCACCATGGGCAACA
CGTGACTTACGCTCCAGCACAAGCCGGTCACGTGACATTCCCTGGTATGTATCATCCGGGACAAGCAGTGACAGCAGCTG
GAGGAGTTCACCATCCGCTCTTACAACAGTCTCAGGGTGTTGCTGGAGCCGAAATGGTTGCACCTGGGCCTCCTAACGTT
TTCCCACAGCCTCAGCAAACACCCATGAATTGGCCAAGTAATTACTGA