Details for Chinese cabbage Locus Brara.E03182

Position : A05 ( 5`- 26012563 .. 26015288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03182

Protein [Map View]
MEQLVEARLDEIRRVIGKADDDPLKIVGVGAGAWGSVFIAMLQENYGTFRDKVSVRIWRRGGRAIDKATAQHLFEVINSR
EELLRRLIRRCAYLKYVEARLGDRVLYADEILKDGFCLNMIETPLCPLKVVTNLQEAVWDADVVVNGLPSTETFQVFSEI
SKYWKERVTAPVIISLAKGVEAEFEPRPRIVTPTQMIYRASNNSFPMFPFDLLAGIPLENILYLGGPNIASEVYNKEYAN
ARICGSEKWRKPLGKFLRQSHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVDTLTKESATSKSVYFAHCTSEMIFITHLLA
KEPEKLAGPLLADTYVTLLKGRNAWYGQKLAKGELNLEMGDSIKGKGMIQGVSAVKAFFELLNQSSLSLQHPEEGKPVTP
AELCPILKMLYRILITRYPYFL*

DNA
ATGGAGCAATTGGTGGAAGCAAGGCTCGACGAGATCCGCAGAGTAATAGGCAAAGCCGACGACGACCCGTTAAAGATCGT
CGGCGTCGGAGCCGGCGCGTGGGGAAGCGTATTCATCGCAATGCTACAAGAAAACTACGGAACATTCAGAGATAAAGTCA
GTGTTCGAATCTGGAGAAGAGGAGGGAGAGCCATCGACAAAGCCACAGCTCAGCATCTCTTCGAAGTGATCAACTCGAGG
GAGGAGCTTCTCAGGAGGCTGATACGACGGTGCGCGTATCTCAAGTACGTGGAAGCTAGGTTAGGCGATAGAGTGCTGTA
TGCAGACGAGATATTGAAAGACGGGTTTTGTTTGAATATGATCGAGACTCCTTTGTGTCCTTTGAAAGTGGTGACGAATC
TTCAGGAGGCGGTTTGGGATGCTGATGTTGTTGTGAATGGTTTGCCTTCGACTGAGACGTTTCAGGTGTTTAGTGAGATT
AGTAAGTACTGGAAGGAGAGGGTTACGGCTCCTGTGATTATCTCTTTGGCTAAGGGTGTGGAAGCTGAGTTTGAGCCTCG
TCCGAGGATTGTTACTCCTACTCAGATGATCTACCGAGCGAGTAACAATTCATTTCCCATGTTTCCTTTTGATCTGCTTG
CTGGAATCCCTCTTGAGAACATTCTTTACCTTGGGGGACCTAACATTGCTTCCGAGGTATACAACAAAGAGTACGCTAAT
GCACGGATCTGCGGGTCCGAGAAATGGAGGAAGCCTCTGGGGAAGTTTCTAAGGCAGTCTCATTTCATAGTGTGGGATAA
CAGTGACCTTGTTACTCATGAAGTAATGGGTGGTTTGAAAAATGTATACGCCATTGGCGCAGGTATGGTGGATACGTTGA
CAAAGGAAAGTGCTACAAGCAAATCAGTGTACTTTGCGCATTGTACTTCAGAGATGATTTTTATTACTCATCTATTGGCC
AAAGAGCCAGAGAAACTTGCTGGACCTTTGCTTGCGGATACCTATGTAACGTTGCTAAAAGGTCGTAATGCGTGGTATGG
TCAGAAGCTCGCAAAAGGAGAACTTAACCTTGAAATGGGTGATAGCATCAAAGGCAAGGGAATGATCCAGGGTGTTTCTG
CGGTGAAAGCGTTTTTCGAGTTACTAAACCAATCCTCGTTAAGTCTTCAACACCCTGAAGAAGGCAAACCTGTAACTCCT
GCTGAGCTCTGTCCCATCTTGAAGATGCTCTACAGAATTCTTATAACAAGGTATCCTTATTTCCTTTGA