Details for Chinese cabbage Locus Brara.E03181

Position : A05 ( 5`- 26008888 .. 26012813 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03181

Protein [Map View]
MAALLASQSCCYVSEAARTTKAIGFSSSLENTFTVESTHSFGTKSKRFRVEMRQSETPSKPGINGRSVKMVPASEVVKRK
NGVNNVNKVNGSAGKVVNGASLVNMNGSASSSTLVKPQKQKPESFLPPPVEGVRVLPSDEGFSWADENYSSFQRSVDVWS
FVLALRIRVLFDNAKWAYIGGFTEEKQKSRRRETASWLRESVLQLGPTFIKLGQLSSTRSDLFPREFVDELSKLQDRVPA
FSPEKARRFIETELGAPISVMYKEFEDQPIAAASLGQVHRAVLHNGEKVVVKVQRPGLKKLFDIDLRNLKLIAEYFQKSE
SFGTNDWVGIYEECATILYQEIDYINEAKNADKFRRDFRNISWVRVPLVYWDYSAMKVLTLEYVPGIKINKLDALAARGY
NRSRIASRAIEAYLIQILKTGFFHADPHPGNLAIDVDESIIYYDFGMMGEIKTFTRTRLLDLFYSVYEKDAKKVMQNLID
LEALQPTGDLSSVRRSIQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFVIRAFSTLEGIGYILDPDFSF
VKVAAPYAQELLDLKQKQNSGTQLVQQIRKQADDARSSTLSMPYRVQRIEEFVKELDSGDLKLRVRVLESERAARKATIL
QMATMYTVLGGTLLNIGVTFSNQGSQLVANGSFVGAGIFMLLVLRSMQRVNKLDKFEKMI*

DNA
ATGGCGGCTTTGCTAGCTTCTCAGAGCTGCTGCTATGTCAGCGAGGCCGCAAGAACCACCAAAGCAATTGGTTTCAGCAG
CTCTCTCGAGAACACATTCACTGTGGAGTCCACTCACTCTTTTGGCACCAAGTCCAAGAGGTTCCGTGTTGAGATGAGAC
AATCAGAGACTCCTTCCAAGCCTGGAATCAACGGACGTTCTGTCAAAATGGTTCCAGCCAGTGAGGTTGTCAAAAGAAAA
AACGGTGTGAATAATGTAAACAAAGTGAACGGTTCAGCTGGAAAAGTTGTTAATGGAGCGAGTTTGGTTAACATGAACGG
CTCTGCGTCTTCTTCAACTTTGGTTAAGCCTCAGAAGCAAAAACCAGAGTCTTTCCTTCCTCCACCTGTTGAGGGCGTTA
GAGTTCTTCCTTCTGATGAAGGTTTCAGCTGGGCTGATGAGAATTACAGCTCGTTTCAACGCAGTGTTGATGTTTGGTCG
TTTGTTCTTGCCCTGAGGATCCGTGTCTTGTTCGACAATGCCAAGTGGGCTTACATTGGAGGCTTCACAGAAGAGAAACA
GAAAAGCAGAAGAAGGGAAACAGCTTCGTGGCTGAGAGAGAGTGTGTTGCAGCTTGGTCCAACGTTTATCAAACTGGGAC
AATTGTCTTCAACTAGATCTGATTTGTTCCCACGTGAGTTCGTTGATGAGCTTTCCAAGTTGCAGGATAGAGTTCCAGCT
TTCTCTCCAGAGAAGGCAAGACGCTTCATAGAGACCGAGCTTGGGGCTCCTATTAGTGTAATGTATAAAGAGTTTGAAGA
CCAACCCATAGCTGCAGCTAGCCTTGGCCAGGTACACAGAGCTGTGTTGCACAATGGAGAGAAAGTGGTTGTGAAAGTAC
AAAGACCTGGACTCAAGAAACTTTTCGATATTGATCTACGAAACTTGAAGTTGATTGCTGAGTATTTCCAGAAAAGTGAA
TCATTTGGTACAAACGACTGGGTTGGTATATACGAAGAATGTGCCACAATCTTGTATCAAGAGATTGACTACATAAACGA
AGCTAAGAATGCAGACAAGTTTAGAAGAGACTTCAGGAATATAAGCTGGGTTCGCGTACCGTTGGTCTACTGGGACTACT
CTGCCATGAAGGTCTTGACTTTGGAGTATGTACCAGGTATCAAGATCAACAAGTTAGATGCCTTAGCTGCACGTGGTTAT
AACCGTTCAAGAATAGCATCACGAGCCATTGAAGCTTATCTTATCCAGATACTCAAAACCGGCTTCTTTCATGCGGATCC
TCACCCAGGGAATCTAGCCATTGATGTAGATGAATCAATCATCTACTATGACTTTGGCATGATGGGAGAGATCAAGACGT
TTACTCGGACGAGGTTGCTTGATCTCTTCTATTCTGTGTATGAAAAAGATGCCAAAAAGGTCATGCAAAACCTTATAGAT
CTTGAAGCACTCCAACCCACTGGAGATCTTTCATCGGTAAGGAGATCTATTCAGTTCTTCTTGGACAATCTATTAAGCCA
GTCCCCAGATCAGCAACAGACTTTGGCAGCTATTGGAGAGGACTTGTTTGCAATTTCACAGGACCAGCCATTCCGTTTCC
CATCAACTTTCACATTTGTCATCAGAGCATTTTCCACACTTGAGGGTATTGGTTACATCCTTGATCCAGACTTTTCCTTT
GTGAAGGTTGCGGCTCCCTATGCGCAGGAACTCCTGGATTTAAAACAAAAGCAAAACTCGGGAACTCAACTTGTCCAACA
AATAAGGAAACAGGCAGACGATGCTAGGTCTTCTACGCTGTCAATGCCATACCGAGTGCAGCGCATAGAAGAGTTCGTTA
AAGAACTTGATTCAGGCGATCTTAAACTCCGTGTCAGAGTTCTTGAGTCGGAAAGAGCAGCTCGGAAAGCGACAATACTG
CAGATGGCGACAATGTACACAGTTCTTGGAGGAACTCTGCTTAACATTGGGGTTACGTTTAGCAACCAAGGAAGTCAGCT
TGTTGCTAATGGATCCTTCGTTGGTGCAGGGATATTCATGTTATTGGTACTGAGATCTATGCAAAGGGTAAATAAGCTTG
ACAAGTTTGAGAAGATGATATGA