Details for Chinese cabbage Locus Brara.E03180

Position : A05 ( 5`- 26004399 .. 26006220 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03180

Protein [Map View]
MASTPMEGKWVQLKQKGTGPGARSSHAIALVGNKVYAFGGEFQPRVPVDNHLHVFDLSTLTWSIQEASGEAPPPRVGVAM
AAVGSIIYFFGGRDENHQELNELYSFNTSTNEWKLLSSGETGPENRSYHSIATDSQNVYVFGGCGVDGRLKDLWAYNVVD
GKWIKFPSPGEGCKGRGGPGLEVVEGRIWVVYGFTGDEADDVHCFDIAKGEWREVETKGEKPSARSVFSTAVVGKQIVIF
GGEVDPSDLGHMGAGCFTAEAYGLDTETLEWRKWEDGFGSEEHPGPRGWCAFAAGSRDGKEGLLVYGGNSPSNDRLGDIF
FFTPESC*

DNA
ATGGCATCGACTCCAATGGAAGGCAAATGGGTTCAGCTAAAACAGAAAGGAACCGGACCAGGAGCAAGAAGCTCTCACGC
CATAGCCCTCGTTGGCAACAAAGTCTACGCCTTCGGCGGCGAGTTCCAACCCCGTGTCCCCGTCGACAACCACCTCCACG
TCTTCGACCTCAGCACTTTAACATGGTCCATCCAAGAAGCTTCAGGGGAGGCTCCTCCTCCTAGAGTAGGCGTAGCCATG
GCTGCAGTAGGATCCATCATCTACTTCTTCGGCGGCCGGGACGAGAATCACCAGGAGCTCAACGAGCTCTACTCTTTCAA
CACTTCCACCAACGAGTGGAAGCTTCTCTCCTCAGGGGAGACAGGTCCTGAAAACAGAAGCTACCACTCAATAGCTACAG
ATTCTCAGAACGTGTATGTGTTTGGTGGGTGCGGAGTGGACGGGCGTCTGAAGGATCTTTGGGCGTACAACGTTGTTGAT
GGGAAGTGGATTAAGTTCCCTTCTCCTGGAGAGGGATGTAAAGGAAGAGGAGGTCCAGGGCTAGAGGTGGTCGAAGGGAG
GATATGGGTTGTGTATGGATTCACAGGAGATGAAGCAGACGATGTGCACTGCTTCGACATAGCTAAAGGAGAATGGAGAG
AAGTCGAGACAAAGGGGGAGAAACCGTCTGCGAGAAGTGTGTTTTCCACTGCGGTTGTTGGGAAACAGATTGTGATATTC
GGAGGAGAGGTTGATCCTAGCGACTTGGGGCATATGGGAGCAGGGTGTTTCACAGCTGAGGCTTATGGGCTTGATACAGA
GACGTTGGAGTGGAGGAAGTGGGAGGATGGGTTTGGGTCAGAGGAGCATCCGGGGCCTAGAGGATGGTGTGCGTTTGCGG
CTGGGTCGAGGGATGGTAAGGAAGGTTTGTTGGTTTATGGAGGGAACTCTCCGAGTAATGATAGGCTTGGTGATATCTTC
TTCTTCACTCCAGAATCTTGCTAA