Details for Chinese cabbage Locus Brara.E03176

Position : A05 ( 5`- 25993634 .. 25995383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03176

Protein [Map View]
MSRDHPPEPLDFFIWTVEDVGYWLEEINLGSYRLIFKENGVNGEYLESMSVFTTEQILHFIRRHHMKWGDFITLCKELRR
IKVACLKGEQRVRRPWWAPSCLSVVFVKAAKRNRQSRVVSLKLES*

DNA
ATGAGCAGAGATCATCCACCTGAGCCTCTTGATTTCTTCATCTGGACCGTTGAGGACGTTGGATATTGGCTTGAAGAGAT
CAACCTTGGAAGCTACCGCCTGATTTTCAAAGAGAATGGTGTCAACGGAGAGTATCTAGAAAGCATGTCTGTGTTCACAA
CGGAACAGATCCTTCACTTCATAAGGAGGCATCACATGAAATGGGGAGACTTTATCACTCTCTGCAAAGAACTCAGAAGG
ATCAAAGTGGCTTGCTTGAAAGGTGAGCAGAGAGTTCGACGGCCATGGTGGGCACCGTCCTGTCTATCAGTAGTCTTTGT
TAAGGCCGCTAAGCGCAACCGACAGTCTCGTGTTGTATCTCTAAAACTTGAGTCTTGA