Details for Chinese cabbage Locus Brara.E03172

Position : A05 ( 5`- 25980504 .. 25981952 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03172

Protein [Map View]
MFLSPGRSPRHLSSPSPSSYSDDGLRISSSRIPPRNPRKRMRVLDEDAYVAAIEKIIERDYFPDISKLRDRLDWLQAVKT
RDPVQIRDAQLKIIERRGKKANHQGGDTVGNKTQTPGSTFLRSFTPLDEFDGSKTPREVEVVVANDGEFNMSLDEFFRRY
TSEDNDSFSNILEKVNKRKKEKYGYLLEKDGDLIEDVKRDRITDGYGTSYQPPSTLDGWKYTAKNLLMYHPADRGEWPLT
QEERAVRLAGLTKEIVKANTRFQGKTMDCRPREDGSVEILYTPIAGSSPMQQVRDRDTSKRYDLDDLRKTPHPFYVESDK
KAGNGYSFVKTPSPAPGVDESPFITWGEIEGTPMRLDPEDTPLDIGGSADGPHYNIPSAPQRDVRAHSLSRDASRRLRER
SNSMFKKPPLPPSPHRSGSASPNVRMLSPAAQKFFRRAIRKSSSAVDESLRASYRGGSPGAVTPKSVSRFGKDRITPGSR
SP*

DNA
ATGTTTCTATCGCCTGGCCGCTCTCCACGTCACCTATCTTCTCCGTCGCCGTCTTCTTACTCCGACGATGGTCTCCGCAT
CTCCTCTTCGAGGATCCCACCTCGGAACCCTAGAAAGCGGATGAGAGTCCTCGACGAGGACGCATACGTCGCAGCGATCG
AGAAGATCATCGAACGCGATTACTTCCCCGATATCTCCAAGCTCAGGGACCGTCTCGACTGGCTCCAGGCGGTTAAAACC
CGCGACCCGGTTCAGATCCGAGACGCACAGTTAAAGATCATCGAGAGGCGTGGGAAGAAAGCTAATCATCAGGGTGGGGA
CACCGTGGGTAACAAAACTCAAACCCCTGGATCTACTTTCTTAAGAAGTTTCACTCCTTTAGATGAGTTTGATGGTTCTA
AGACCCCTAGAGAAGTCGAAGTAGTAGTTGCTAATGATGGTGAGTTTAATATGTCGTTAGACGAGTTCTTTAGGAGGTAT
ACAAGTGAGGATAACGATAGCTTCTCAAACATCTTGGAGAAGGTTAATAAGAGGAAGAAGGAGAAGTATGGTTATCTCCT
TGAGAAGGATGGTGATTTGATTGAGGATGTGAAGAGAGACAGGATCACAGATGGATACGGTACTTCTTATCAACCACCGA
GTACTTTAGATGGGTGGAAGTACACAGCGAAGAATCTTCTCATGTACCATCCAGCTGACCGCGGCGAGTGGCCGTTGACT
CAAGAGGAGAGGGCTGTGAGGTTAGCGGGACTGACCAAGGAGATTGTTAAGGCCAATACACGTTTTCAAGGGAAGACGAT
GGATTGCAGGCCGAGGGAAGATGGGTCTGTTGAGATTCTCTACACTCCCATCGCAGGCTCTTCACCTATGCAGCAGGTTA
GGGATAGAGACACCTCCAAGAGGTATGATCTTGATGATTTGAGGAAGACTCCGCATCCTTTCTACGTGGAGTCGGATAAG
AAGGCGGGTAACGGGTATAGTTTTGTCAAGACGCCGTCTCCTGCACCTGGTGTTGACGAGTCGCCTTTTATAACGTGGGG
GGAGATCGAAGGGACGCCGATGAGACTAGACCCCGAGGATACGCCTCTTGATATTGGCGGGAGTGCTGATGGACCTCACT
ACAACATTCCCTCCGCGCCTCAGAGGGACGTGAGGGCGCATTCTTTGTCGAGGGACGCGTCGCGGAGGCTGAGGGAGAGG
TCGAACAGTATGTTTAAGAAGCCTCCGTTGCCGCCGTCTCCTCATAGGAGTGGAAGTGCGAGTCCGAATGTGAGGATGCT
TTCTCCTGCTGCTCAGAAGTTTTTTAGGCGGGCGATAAGGAAGTCTTCTTCTGCTGTTGATGAGAGCCTTCGTGCGAGTT
ACCGTGGGGGGAGTCCTGGTGCTGTGACTCCTAAGAGTGTGTCTAGATTTGGTAAAGATAGGATCACCCCTGGTTCAAGG
TCGCCTTGA