Details for Chinese cabbage Locus Brara.E03171

Position : A05 ( 5`- 25973864 .. 25976324 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03171

Protein [Map View]
VILKDRTTGRARGFGFVVFADPAVAEFVITEKHHIDGRLVEAKKAVPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGL
PSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEEAVDKVLLKTFHELNGKMVEVKRAVPKEMSPGPARS
PLGAAGYSYGVNRVNNLLNGYAQGFNPGAVGGYGLRMDGRFSPVGAGRSGFANFGSGYGMNMNFDQGLPTGFTGGNGNLE
YGRGMSPYYIGNANRFGPGPAVGYEGSNGGGGGGNSSFFSSVTRNLWGNNGGLNYNNNNNNAANSNSNSNTYMGGGGSSS
GNNNTLSGGPFGNWGAPGGGGGGNNAVGNENAKFGYGGNGDSGFGYAARSIGPSKAAAPSSSFSSANNTGYDGAGLAEFY
GNGAVYSDPTWRSPTPPETEGPASFSYGIGGGGGGPSSDVSARSSSPGYVGSYKRQPNRGEAPSR*

DNA
GTGATCTTGAAAGATCGCACCACTGGTCGTGCACGTGGCTTCGGCTTTGTTGTCTTCGCTGATCCTGCTGTTGCTGAGTT
TGTTATTACAGAGAAGCATCACATCGATGGGAGATTGGTTGAAGCCAAGAAGGCTGTTCCTAGAGATGACCAGAACATGG
TAACTAGAAGCAACAGCAGCAGCATCCAAGGATCACCTGGTCCAGGAGCTCGGACAAGGAAGATATTCGTCGGAGGGCTA
CCTTCCTCCGTCACAGAGAGCGACTTCAAGACCTACTTTGAGCAGTTCGGGACAACGACCGACGTGGTTGTTATGTACGA
CCACAACACACAAAGGCCTAGAGGTTTCGGATTCATTACTTATGACACCGAGGAGGCCGTTGATAAAGTGCTGCTCAAGA
CGTTCCATGAGCTCAACGGTAAGATGGTCGAGGTTAAGAGGGCTGTGCCTAAGGAGATGTCTCCAGGTCCAGCTCGTAGC
CCTCTTGGTGCTGCTGGTTACAGCTATGGAGTTAATAGGGTTAATAACCTTCTTAATGGATATGCTCAAGGGTTTAATCC
GGGTGCGGTTGGTGGCTACGGGCTTAGGATGGATGGCCGGTTTAGTCCGGTTGGTGCTGGGAGAAGCGGGTTTGCGAATT
TCGGTTCTGGCTATGGGATGAATATGAACTTTGATCAGGGGTTGCCCACAGGGTTCACTGGAGGTAATGGAAACTTGGAG
TATGGGAGAGGGATGAGTCCTTACTACATTGGGAATGCAAACCGGTTTGGTCCTGGTCCTGCTGTTGGTTATGAAGGAAG
CAATGGAGGAGGAGGGGGAGGGAACTCGTCCTTCTTCAGTTCGGTTACAAGGAACCTATGGGGAAACAACGGTGGTCTTA
ACTATAACAACAACAACAACAACGCTGCAAACTCAAACTCAAACTCCAATACATACATGGGAGGAGGAGGATCATCAAGT
GGGAACAACAACACGCTTAGCGGCGGGCCGTTTGGAAACTGGGGTGCTCCTGGAGGTGGAGGTGGAGGAAACAATGCTGT
TGGTAACGAGAATGCGAAGTTTGGTTATGGAGGAAACGGTGATTCTGGTTTTGGGTATGCAGCAAGGAGCATAGGGCCTA
GCAAGGCAGCAGCACCGTCGTCTTCCTTCTCTTCTGCCAATAACACTGGTTACGATGGAGCAGGACTTGCAGAGTTTTAT
GGGAATGGTGCAGTGTATAGTGATCCCACGTGGAGATCACCAACTCCTCCTGAGACAGAAGGGCCTGCTTCTTTTAGCTA
TGGGATTGGAGGAGGAGGAGGAGGTCCTTCCTCGGATGTTTCAGCTAGAAGTTCATCTCCAGGTTATGTTGGCAGTTACA
AGAGACAACCAAACAGAGGCGAGGCTCCATCAAGGTGA