Details for Chinese cabbage Locus Brara.E03167

Position : A05 ( 5`- 25928248 .. 25929982 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03167

Protein [Map View]
MSGAVSGSRDMGFVDNNNNKKDGDDGNTSKTASSHQHEGTDDEGAGSLGRQMSEASLSAAEEEEDDDSKLQLGPQYTIKE
HLEKDKDDESLRKWKEQLLGSVDVTNIGETLDPEVKIISLVILSPGRPDIVLMVPENGNPKGMWFTLKEGSRYCLKFTFQ
VKNNIVSGLRYTNTVWKTGVKVDRGKEMLGTFSPQSEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFD
IRKEWPAV*

DNA
ATGTCTGGAGCTGTATCTGGTTCCAGGGACATGGGTTTCGTCGACAACAACAACAACAAGAAAGATGGAGACGACGGTAA
CACTTCCAAAACGGCGTCGTCTCATCAACACGAGGGCACCGACGACGAGGGCGCTGGATCCTTGGGGAGGCAAATGAGCG
AAGCCTCTCTTAGCGCAGCTGAGGAGGAAGAAGACGATGACTCCAAATTACAATTGGGTCCTCAGTACACTATCAAGGAA
CATCTCGAGAAGGATAAGGATGATGAGAGTCTGAGGAAGTGGAAAGAACAGCTCCTTGGAAGTGTTGATGTCACCAACAT
TGGAGAGACTCTTGACCCTGAAGTGAAGATCATTAGCCTGGTGATCTTATCGCCAGGAAGACCAGATATTGTTCTAATGG
TTCCGGAGAATGGGAACCCAAAGGGGATGTGGTTTACTTTGAAAGAAGGGAGCAGGTACTGTTTGAAATTCACGTTTCAG
GTTAAAAACAACATTGTCTCTGGTCTTAGGTACACCAATACTGTTTGGAAGACCGGTGTTAAAGTGGATAGAGGAAAGGA
AATGCTTGGAACCTTTAGTCCTCAGTCGGAGCCATACAACCACGTGATGCCTGAAGAGACCACTCCTTCTGGCATGTTTG
CTCGAGGATCTTATTCTGCTAGAACTAAGTTTCTTGATGATGATAACAAGTGCTACTTGGAGATCAACTACAGCTTCGAC
ATCCGTAAAGAATGGCCTGCTGTTTGA