Details for Chinese cabbage Locus Brara.E03166

Position : A05 ( 5`- 25925025 .. 25927514 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03166

Protein [Map View]
MFGIQNRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGFTVEGNVDDVNVLNEVREKVRNQGRVWWALEASKGANWY
LQPEILMIGDGIALKKTSLKISTLTNAITLKRLVRKGIPPVLRPKVWFSLSGAAKKKSTVPESYYSDLSKAVDGKVTPAT
LQIDHDLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAFWMLAVLLENVLVRDCY
TTNLSGCHVEQRVFKDLLAQKCPRIATHLDDMGFDVSLVATEWFLCLFSKSLPSETTLRVWDVLFYEGAKVLFHAALAIF
KMKENELLMTHQVGDVINIIQTTSHQLFDPDELLTVAFEKIGSMTTNTISKQRKKQEPAVLAELDQRLRRLNSLKETGKN
T*

DNA
ATGTTTGGGATCCAAAACAGGCGAGACCTAACGATGGAGCTCCAATCCCAGATCCCCATCCTCCGCCCCAGCATCCACGC
CCGCCGCGCCAACATCGTCGTCAAGTTCCAGGACCTCTACGGGTTCACGGTGGAAGGCAATGTCGACGACGTGAACGTGC
TCAACGAGGTTCGAGAGAAGGTGAGGAACCAGGGGCGGGTGTGGTGGGCTTTGGAAGCTAGCAAGGGAGCTAACTGGTAT
CTCCAGCCGGAGATTCTCATGATCGGCGACGGTATCGCCTTGAAGAAGACGTCTCTCAAGATCTCGACTTTGACGAATGC
GATTACGTTGAAGAGGTTGGTTAGGAAAGGGATCCCTCCTGTGTTGAGGCCTAAGGTTTGGTTCTCTCTCTCTGGCGCTG
CGAAGAAGAAGTCTACTGTGCCGGAGAGTTATTATAGTGATTTGAGTAAGGCTGTTGATGGGAAGGTTACGCCTGCTACG
CTGCAGATTGATCATGATCTGCCAAGGACATTCCCAGGCCATCCATGGTTGGATACTCCAGAGGGTCATGCTGCTCTACG
ACGTGTGCTTGTTGGCTATTCTTTTCGTGACTCTGATGTTGGCTATTGTCAGGGGCTAAACTACGTAGCAGCGTTACTAT
TGCTTGTGATGAAGACAGAAGAAGACGCGTTCTGGATGCTAGCAGTCCTTTTGGAAAACGTATTGGTCCGTGACTGCTAC
ACGACCAACTTGTCTGGATGCCATGTTGAGCAGCGGGTTTTCAAAGATCTGCTCGCCCAAAAGTGTCCTCGAATAGCTAC
TCATCTTGACGATATGGGCTTTGATGTATCCCTTGTAGCCACTGAGTGGTTTCTATGCCTCTTCTCCAAAAGCTTGCCTT
CTGAGACAACTCTAAGAGTGTGGGATGTACTTTTCTATGAAGGAGCAAAGGTTCTTTTCCATGCAGCTTTGGCAATATTC
AAGATGAAAGAAAACGAGCTGCTTATGACTCACCAGGTCGGTGATGTGATCAACATAATACAGACCACCTCACACCAGCT
CTTTGACCCTGATGAATTATTGACGGTGGCATTTGAGAAAATTGGATCAATGACAACCAACACAATATCAAAGCAGAGGA
AGAAGCAGGAACCGGCGGTGCTGGCAGAACTTGACCAGAGACTTCGCAGACTCAACTCTCTTAAAGAAACTGGTAAGAAC
ACTTGA