Details for Chinese cabbage Locus Brara.E03165

Position : A05 ( 5`- 25919765 .. 25922185 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03165

Protein [Map View]
MGTWKKKNSYTNKVSYISVPAQIIKSVSSSSLRDNKSSKRNTTKFLFLLLRNPRLWAFCLLSLSVLGIVSRLGPCLSPSG
PHQESQLRSSDSIAYTRSNSTHAEIPNADDPSLDMIPKPPVAVVEKNETFGGDSKLIITSRHAFWKQPDGLGYKPCLDFS
AAYRRESKRVVRERRKYLMVVVSGGMNQQKNQIVDAVVIARILGAVLVVPVLQVNLIWGDESEFSDIFDLERFKSVLADD
VKIVSLLPANKIMTRPTEDGGMPFNASPQWIRSHYLKRFNRDGVLLLRRLDSRLSKDLPSDLQKLRCKAAFEALKFSPSV
MELGKKLAERMRSKGPYIALHLRLEKDVWVRTGCLTGLSSKYDEIARLEGIKRPELLTAKSSMTPNERKLAGLCPLNAKE
VTRLLRALGAPRDARIYWAGGEPLGGKEALRPLTSEFPHLYNKYDIALPLELKPFAKRASIMAAIDYIVCKESDVFMASH
GGNMGRAIQGHRAYEGHKKLITPNKRQMLPYFLNTSMTETEFEQMMKKLHRQSLGQPEIRVSKAGRDVTKYPVPECMCNN
QSTPTI*

DNA
ATGGGAACATGGAAGAAGAAAAACAGTTATACGAACAAAGTTAGCTACATATCAGTCCCAGCTCAGATCATAAAGTCAGT
TTCTTCCTCGTCTCTTCGAGACAATAAATCTTCAAAGAGGAACACGACCAAGTTCTTGTTTCTTCTCCTCAGAAACCCAA
GGCTCTGGGCGTTCTGTCTCCTCTCGCTTTCTGTTTTAGGAATTGTATCACGACTTGGTCCTTGTCTTTCTCCTTCCGGT
CCACATCAAGAAAGTCAACTTCGAAGCTCGGATTCAATTGCGTATACCCGATCAAACAGTACTCATGCTGAGATTCCGAA
TGCAGATGATCCATCTTTAGATATGATTCCAAAACCACCAGTGGCTGTTGTGGAGAAGAATGAGACCTTTGGTGGTGATT
CAAAGCTGATCATCACCTCTAGACATGCTTTTTGGAAACAGCCTGATGGATTAGGATACAAGCCGTGCCTGGACTTCAGC
GCTGCGTACAGGAGAGAGAGCAAGAGGGTTGTTAGAGAGAGGAGAAAGTATCTGATGGTGGTTGTCTCCGGTGGGATGAA
CCAGCAGAAGAATCAGATTGTGGATGCAGTTGTGATTGCCAGGATCCTAGGTGCTGTTCTTGTCGTCCCAGTATTGCAAG
TCAATCTAATTTGGGGTGACGAGAGTGAGTTTTCAGATATATTTGATTTAGAGAGGTTCAAGAGTGTTTTAGCAGATGAT
GTTAAGATAGTTTCATTGCTGCCGGCAAATAAAATAATGACTAGACCAACAGAAGATGGTGGTATGCCTTTCAATGCCTC
TCCTCAATGGATCCGTTCACACTATCTAAAACGATTTAACAGGGATGGAGTTCTGCTTTTAAGGAGATTGGATTCAAGAT
TGTCTAAAGACTTACCCTCTGATCTCCAGAAGCTTCGTTGTAAGGCAGCATTTGAAGCGCTGAAGTTCTCGCCAAGTGTG
ATGGAGTTGGGGAAGAAGCTAGCAGAGAGGATGAGGAGCAAAGGTCCTTACATTGCGCTTCATCTTCGGTTGGAGAAAGA
CGTGTGGGTGAGAACAGGCTGCCTTACTGGTTTGAGCTCAAAGTATGATGAGATTGCGAGACTAGAAGGGATTAAGCGGC
CTGAGCTCTTAACGGCCAAGTCTAGCATGACACCTAATGAGAGGAAACTCGCAGGTCTATGTCCGTTAAATGCCAAGGAA
GTAACAAGGCTGCTTAGAGCACTTGGAGCACCGAGAGACGCGAGGATCTACTGGGCAGGAGGGGAACCTCTGGGCGGAAA
GGAAGCTCTGAGACCGTTAACAAGTGAATTCCCACATCTTTACAACAAATACGATATAGCATTGCCCCTTGAACTCAAAC
CTTTCGCGAAGCGAGCTTCAATAATGGCAGCAATAGACTATATAGTATGCAAGGAGAGTGATGTGTTCATGGCATCTCAT
GGAGGGAACATGGGCCGCGCGATTCAGGGTCACAGAGCTTATGAAGGACACAAGAAGCTTATAACACCAAACAAAAGGCA
AATGCTCCCATACTTTTTGAACACATCAATGACTGAGACAGAGTTTGAGCAGATGATGAAGAAATTACACAGGCAATCTC
TAGGACAGCCAGAGATAAGGGTTAGCAAAGCTGGAAGAGATGTTACAAAGTATCCTGTTCCTGAGTGTATGTGCAATAAT
CAATCCACTCCCACTATTTAA