Details for Chinese cabbage Locus Brara.E03164

Position : A05 ( 5`- 25918628 .. 25919765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03164

Protein [Map View]
MARETSCLTRITAGVAIGGALGGAVGAVYGTYEAIRFRVPGLMKIRYIGQTTLGSAAIFGLFLGAGSLIHCGK*

DNA
ATGGCTAGAGAAACAAGTTGTTTGACCAGAATCACTGCCGGAGTTGCAATCGGCGGCGCACTTGGCGGTGCTGTAGGTGC
TGTCTATGGAACTTACGAGGCGATTAGATTCAGGGTGCCTGGGCTTATGAAGATAAGGTACATTGGGCAAACAACACTCG
GCAGCGCAGCAATTTTTGGGCTTTTCCTAGGTGCAGGCAGTTTGATACACTGTGGAAAATAA