Details for Chinese cabbage Locus Brara.E03163

Position : A05 ( 5`- 25914965 .. 25917379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03163

Protein [Map View]
MSQFFSEHLSCSRCLGSSLEMSLGQANVNPIEVSSGSHACLYDLLCSETPRGTLQKDFQTSTSDPRDRLEKLLKQSGNKY
CADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVFSIKLDEWTDEQVDMLVGYGGNSAVNQRFEACNMDQLKKPKP
NSNNEERNDFIRKKYELHQFMDPQDSALCTYEQPTIINNSLPSLCSASASHRSAKNRIGQAFRNSWGRRESDHKCPKKSN
SMAGMVEFVGLIRVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIPEQMPPLKVLVYDKDT
FTTDDFMGEAEIDIQPLVSAAIAYETSSIKEPMQLGSWVASKENTLVSDGIISQDEGKVKQDISLRLQKVERGVLEIQLE
CLPLTQ*

DNA
ATGTCCCAGTTCTTTTCTGAACATCTATCGTGTTCTCGTTGTCTCGGGTCTAGTTTAGAAATGTCTCTCGGCCAAGCAAA
TGTCAATCCTATCGAAGTTTCTTCTGGGTCGCATGCTTGTTTATATGACCTTTTATGTTCAGAGACACCAAGAGGGACTC
TTCAAAAGGATTTTCAGACATCAACTTCTGATCCTCGAGATCGGTTGGAGAAGTTGTTGAAGCAATCTGGTAATAAGTAT
TGTGCTGACTGTGGATCTCCTGAACCTAAATGGGTATCGTTAAGTCTTGGTGTATTTATATGCATAAAGTGTTCTGGTGT
ACACAGAAGTCTTGGAGTTCATATATCAAAGGTTTTTTCAATTAAGCTAGATGAGTGGACAGATGAGCAAGTTGATATGC
TTGTAGGGTACGGTGGAAACAGTGCAGTGAACCAGAGATTCGAAGCTTGCAACATGGACCAGTTAAAGAAACCAAAACCA
AATTCTAATAATGAGGAACGCAATGATTTCATCAGGAAGAAATATGAGCTGCACCAGTTTATGGATCCACAAGATAGTGC
TTTGTGCACTTATGAGCAGCCTACCATAATAAATAATTCACTACCGTCTTTATGTTCTGCTAGTGCTAGCCACCGGTCTG
CAAAAAACCGTATTGGTCAAGCATTTAGGAATAGCTGGGGAAGAAGAGAATCGGATCACAAATGCCCCAAGAAGAGCAAT
TCTATGGCAGGTATGGTTGAGTTTGTCGGATTGATTAGAGTTAATGTGGTTAAAGGAACAAACCTTGCGGTTCGAGATGT
GATGACCAGCGATCCTTATGTTATCCTTTCTCTTGGACAACAATCGGTGAAAACAAGAGTGATAAAGAACAACTTGAATC
CTGTGTGGAATGAGACCTTGATGCTTTCCATACCTGAGCAGATGCCTCCTCTCAAAGTGCTAGTGTACGACAAGGATACA
TTCACGACAGACGATTTCATGGGGGAGGCAGAGATAGACATACAACCATTGGTGAGTGCAGCAATAGCTTACGAGACATC
TAGCATAAAAGAACCGATGCAGCTGGGGAGTTGGGTGGCGAGCAAAGAGAACACATTGGTGAGTGATGGGATAATCTCAC
AGGACGAAGGAAAAGTGAAACAAGACATATCCCTCAGGCTTCAAAAAGTGGAGAGAGGTGTTCTTGAGATACAACTTGAA
TGTCTTCCTCTCACTCAATGA