Details for Chinese cabbage Locus Brara.E03157

Position : A05 ( 5`- 25893919 .. 25899089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03157

Protein [Map View]
MTETGDLNSVPAIGIRPIPFLFIFKDLTHVFSMDAIGREILSMAFPAALALASDPVASLIDTAFIGRLGAVELAAVGVSI
AIFQQASRITIFPIVSVTTSFVAEEDTLEKIKEEEEEANKANNVHANTLAIQDSLEKGVASTTSNNKKQPQQTPVDVKLT
SDTKSNNGNKANKKGKKTIKSASTAMIIGLTLGLVQAIVLIFSSKVLIGIMGVKPNSAVLSPAQKYLTIRSLGAPALLLS
LSMQGIFRGFKDTKTPLYATVASDGLNIIIDPIFIFVLRLGVSGAAIAHVISQYFMLLILLIRLAKEVNLMPPKFGDLQF
GKFIRNGGLMLARTIAVTFCQTLAASMAARLGTTPMAAFQICLQVWLTSSMLADGLAVAGQAILACNFAEKDYNKVTAAA
SRVIQMSLVLGLGLSVFVGLGLYFGSGVFSKDPAVIHLIAIGIPFVAATQPINSLTFVLDGVNFGASDFAYTAYSMVGVA
AVSIAAVIYMAKVNGFVGIWIALTIYMGLRAVTGIGRMATGTGPWKFLRGRSPSSS*

DNA
ATGACAGAAACTGGTGATCTTAATTCCGTTCCAGCCATCGGGATCAGGCCGATCCCATTTCTTTTTATCTTCAAAGATTT
AACCCATGTATTCAGTATGGATGCAATTGGGCGAGAGATACTAAGCATGGCCTTTCCAGCGGCTTTAGCTTTAGCTTCTG
ATCCAGTAGCCTCTCTGATTGACACTGCTTTTATAGGACGTTTAGGAGCGGTTGAGCTAGCAGCGGTTGGAGTATCCATT
GCGATATTCCAACAAGCTTCTAGAATCACGATATTCCCAATTGTGAGCGTCACAACTTCCTTTGTCGCTGAGGAAGACAC
ATTGGAAAAAATAAAAGAAGAAGAAGAAGAAGCAAACAAAGCCAATAATGTTCATGCAAATACTTTGGCTATTCAAGATT
CCTTGGAAAAAGGCGTTGCGTCAACCACAAGTAACAACAAAAAACAGCCGCAGCAAACGCCAGTTGACGTGAAACTAACT
TCGGATACAAAGTCAAACAACGGAAACAAAGCAAATAAGAAAGGAAAGAAGACTATCAAATCGGCATCAACAGCCATGAT
CATAGGTTTGACCCTAGGCCTTGTGCAAGCTATTGTCTTGATTTTCAGCTCGAAGGTGCTTATAGGCATCATGGGAGTTA
AACCGAATTCGGCAGTTTTATCACCAGCGCAAAAGTACTTGACCATACGATCATTAGGTGCTCCTGCATTGCTTTTGTCG
CTTTCAATGCAAGGCATCTTCCGTGGCTTTAAGGACACCAAAACTCCTCTTTATGCTACTGTTGCATCAGATGGTCTCAA
TATCATTATCGACCCCATTTTCATATTTGTGCTTCGCCTTGGCGTCAGCGGTGCCGCCATTGCTCATGTCATTTCTCAGT
ACTTCATGCTTCTTATATTGTTGATCCGCCTCGCTAAAGAAGTTAATTTGATGCCACCAAAATTTGGCGACCTACAGTTC
GGAAAGTTCATTAGAAATGGGGGATTAATGCTGGCAAGGACCATAGCTGTGACATTTTGTCAGACCTTAGCAGCATCAAT
GGCGGCTCGGCTCGGAACGACACCAATGGCTGCATTCCAGATATGTTTACAAGTCTGGTTAACGTCTTCTATGCTTGCTG
ATGGTCTTGCCGTTGCTGGTCAGGCGATTCTGGCTTGTAATTTTGCCGAAAAGGACTACAACAAAGTGACCGCTGCTGCG
TCACGTGTTATACAGATGAGTTTGGTGTTAGGACTTGGACTGTCCGTTTTTGTCGGACTGGGTCTATACTTTGGTTCCGG
GGTATTCTCCAAGGATCCTGCCGTTATTCACCTCATAGCCATTGGAATACCGTTTGTAGCAGCGACACAGCCAATAAACT
CACTCACTTTTGTATTGGACGGAGTCAATTTTGGAGCATCTGATTTTGCTTACACTGCATACTCCATGGTAGGAGTTGCG
GCCGTAAGCATTGCAGCAGTTATTTACATGGCGAAGGTCAATGGTTTTGTAGGAATATGGATAGCTCTTACGATCTATAT
GGGTCTCCGTGCTGTTACAGGAATTGGCAGGATGGCAACAGGAACCGGACCGTGGAAATTCTTGCGTGGACGATCCCCTT
CATCTTCCTAG