Details for Chinese cabbage Locus Brara.E03155

Position : A05 ( 5`- 25882905 .. 25884704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03155

Protein [Map View]
MMMRNQDITTIRDKNKANNACGGNNNKPKLRKGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYLR
PDLKRGSFSPQEEDLIFHLHSILGNRWSQIATRLPGRTDNEIKNFWNSTLKKRLKNNNTSSGSSPNNSNSNSLEPIDQQV
DMGGNSNPMMNSYHHQDDMMIVGNTMHMDSSSFYAPVVSGVGLNQLDPLISVPDHSRYQQMGNTGNNNVNGLGDYGSAVL
DPISNRASVENEWFLPPSENTNGIACATSNNLNLEALDLCFSSKNMCHSESFKVGNIMGMENSSWEIENPKIGDWDLDSL
IDNNSSFPFLDFQVE*

DNA
ATGATGATGAGGAATCAGGACATTACTACGATCAGAGACAAGAACAAGGCAAATAATGCATGTGGTGGTAATAACAACAA
ACCGAAGCTAAGAAAGGGACTTTGGTCTCCTGATGAAGACGAGAAGCTCATAAGGTATATGTTGACCAATGGACAAGGGT
GTTGGAGTGACATTGCTAGGAATGCTGGTCTCTTACGTTGTGGCAAAAGTTGTCGCCTTCGTTGGATCAATTACTTGAGG
CCTGATCTTAAACGTGGCTCTTTCTCTCCTCAAGAAGAAGATCTCATCTTCCATTTGCATTCCATTCTTGGTAACAGGTG
GTCTCAAATAGCCACTCGGCTTCCAGGAAGGACAGACAACGAGATCAAAAACTTTTGGAACTCGACATTGAAGAAGAGGC
TTAAGAACAACAACACTTCTTCAGGTTCATCACCTAATAATAGTAATAGTAACTCTTTGGAACCAATAGATCAACAAGTG
GACATGGGAGGCAACTCAAATCCAATGATGAATAGCTATCATCATCAAGATGACATGATGATAGTGGGGAACACCATGCA
CATGGACTCTTCCTCATTTTATGCACCCGTGGTTAGTGGTGTGGGATTAAACCAACTTGATCCATTGATATCAGTACCGG
ATCATAGCCGATATCAACAAATGGGAAACACAGGGAACAACAACGTTAATGGGTTAGGAGATTATGGAAGCGCAGTTCTT
GATCCGATCAGCAATAGAGCATCAGTAGAAAATGAATGGTTTCTTCCACCGTCCGAGAATACCAATGGCATTGCTTGTGC
CACAAGCAACAACCTAAACTTAGAAGCCCTTGATCTTTGCTTCAGTAGCAAAAATATGTGTCATTCAGAAAGCTTCAAAG
TAGGGAACATTATGGGTATGGAGAATAGTTCTTGGGAAATAGAAAACCCTAAAATCGGAGATTGGGATTTGGATAGTCTC
ATCGATAACAACTCTTCTTTCCCCTTCCTTGATTTCCAAGTTGAATGA