Details for Chinese cabbage Locus Brara.E03151

Position : A05 ( 5`- 25863190 .. 25865254 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03151

Protein [Map View]
MKSMQHHRAPLISSSSSQSNSFITRLLLLLTLLPVSLACLAFILQWRGGGGLADPASASVISSTSVPGGNSDLNHEVFPG
METVSSVSPKAHQSSSSDCSNLARSSSPSFPYYGDWNFGVDSNLKPKICITTSTSAGLDQILPWMFYHKVLGVSTFFLFV
EGKAATPTISKVLESIPGVKVIYRTKDLEEKQAKSRIWNETWLSSFFYKPCNYELFVKQSLNMEMAIVMAREAGMDWILH
LDTDELIYPAGTREHSLRRLLLDVPPNVDMVIFPNYESSVERDDIKDPFTEVSMFKKNYDHLPKDTYFGMYKEATRNNPN
YFLTYGNGKSVARVQDHLRPNGAHRWHNYMKTPNEIKLEEAAVLHYTYAKFSDLTSRRDRCGCKPTKEDVKRCFMLDF

DNA
ATGAAATCGATGCAACACCACAGAGCTCCACTAATCTCTTCATCTTCCTCTCAAAGCAACTCTTTCATCACCAGACTTCT
CCTTCTACTGACTCTACTCCCAGTCTCCCTCGCCTGCCTCGCCTTCATCCTCCAATGGCGAGGCGGCGGCGGCCTCGCCG
ATCCCGCCTCCGCTTCCGTCATCTCCTCAACCTCAGTCCCCGGCGGTAACTCCGATCTCAACCACGAGGTGTTCCCCGGA
ATGGAGACTGTCTCATCCGTCTCCCCGAAAGCTCACCAATCTTCTTCATCCGACTGCTCGAATCTAGCTCGAAGCTCTTC
CCCTTCCTTTCCTTACTACGGTGATTGGAACTTCGGTGTTGATTCCAATCTAAAGCCTAAGATATGTATCACGACTAGCA
CATCAGCGGGGTTGGATCAGATTCTACCGTGGATGTTTTACCATAAGGTTCTTGGCGTCTCCACGTTTTTTCTTTTTGTG
GAAGGGAAAGCTGCTACGCCCACCATTTCTAAAGTCCTGGAGTCCATTCCTGGGGTGAAGGTGATATACAGGACAAAAGA
TCTTGAGGAGAAGCAGGCAAAGAGCCGGATTTGGAATGAGACGTGGCTGTCTTCTTTCTTTTACAAGCCATGCAATTATG
AGTTGTTTGTCAAGCAATCTCTCAACATGGAAATGGCTATTGTCATGGCAAGGGAGGCGGGCATGGATTGGATACTTCAC
CTTGACACAGATGAGCTAATATACCCAGCAGGCACTCGTGAGCACTCACTGAGACGCTTGCTTCTTGATGTTCCTCCAAA
TGTTGATATGGTTATATTCCCAAATTATGAAAGCAGCGTGGAACGAGATGATATCAAGGATCCTTTTACAGAGGTGTCAA
TGTTTAAGAAGAACTATGACCATCTCCCAAAAGATACATATTTTGGAATGTACAAAGAAGCAACAAGAAACAATCCAAAC
TACTTCTTGACTTATGGTAACGGCAAATCAGTTGCTCGAGTTCAAGATCACCTCCGACCAAATGGAGCACACAGATGGCA
TAATTACATGAAGACTCCCAATGAGATCAAATTGGAGGAGGCTGCTGTGTTACACTACACATATGCCAAGTTCTCGGACT
TAACATCCAGACGAGATCGATGTGGATGCAAGCCTACAAAAGAAGACGTGAAAAGATGCTTTATGTTGGATTTT