Details for Chinese cabbage Locus Brara.E03149

Position : A05 ( 5`- 25849909 .. 25851221 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03149

Protein [Map View]
MAAIARLHLSAKPNQTGPRAINLTRDPRLVVSFPRNASVCSSLRTSPNLVASSAGGGGSGGNFVGSGGGGGGGGDNGDSG
GKQEPSPWGPIGMFIQGWRSRVAADPQFPFKVLMEELVGVTANVLGDMASRPNFGLNELDFVFSTLVVGSILNFTLMYLL
APSLASSTSSNLLPGIFKTCPASHMFEQGSFTVVNRFGTLVYKGMVFATVGLAAGLVGTAISNGLIMLRKKMDPGFEPPN
KAPPTVLNSLTWAAHMGVSANVRYQTLNGVEFLMERGLPPLVFKTGVVALRVVNNLLGGMSFVVLARLTGSQSVGEEKVE
EKDD*

DNA
ATGGCGGCTATAGCTCGTCTCCACTTGTCGGCTAAACCGAACCAGACCGGTCCTAGAGCGATCAACCTCACGCGCGATCC
AAGGCTCGTCGTCTCGTTTCCACGCAATGCATCGGTATGTTCCTCCCTCCGCACATCTCCAAATCTAGTTGCTTCATCCG
CCGGAGGAGGAGGCAGCGGTGGAAACTTCGTTGGAAGCGGAGGCGGCGGTGGTGGCGGCGGTGATAACGGAGATTCAGGA
GGGAAGCAAGAACCGTCTCCATGGGGACCGATAGGGATGTTCATCCAAGGATGGAGATCACGCGTCGCAGCTGATCCTCA
GTTCCCTTTCAAAGTCCTCATGGAAGAGCTCGTTGGAGTAACCGCCAACGTACTCGGTGACATGGCTTCACGCCCCAACT
TCGGACTCAACGAGCTAGACTTCGTCTTCTCAACCCTCGTCGTGGGTTCGATCCTCAACTTCACGCTCATGTACCTCTTA
GCACCCTCTTTAGCATCCTCCACCTCCTCCAACCTCTTGCCTGGGATCTTTAAAACCTGTCCAGCTAGTCACATGTTCGA
GCAGGGGAGCTTCACGGTCGTGAACCGCTTCGGGACTTTAGTGTACAAAGGAATGGTGTTCGCCACCGTGGGGCTAGCTG
CGGGGCTTGTGGGGACGGCTATCTCTAATGGGTTGATCATGCTGAGGAAGAAGATGGACCCCGGGTTCGAGCCGCCGAAT
AAGGCTCCCCCGACGGTGCTGAACTCGTTGACTTGGGCGGCTCATATGGGAGTGAGCGCTAACGTGAGGTACCAGACGTT
GAACGGGGTTGAGTTTTTGATGGAGAGAGGGTTGCCGCCGTTGGTGTTTAAGACGGGTGTGGTGGCTTTGAGGGTTGTGA
ACAATCTTTTGGGAGGGATGTCGTTTGTTGTGTTGGCGAGGTTGACTGGTTCGCAGTCTGTGGGGGAGGAGAAGGTGGAG
GAGAAAGATGATTGA