Details for Chinese cabbage Locus Brara.E03146

Position : A05 ( 5`- 25837879 .. 25841255 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03146

Protein [Map View]
MNRNLRESLAGGRNTPAISQFRRGNISQNGFSRDSDENLDLFSKIRRSFPLASSDELPDVSAKLGRLSVGSKPAPRGKGD
DLLSSAEGGKNDYDWLLTPPGTPLGNDSHSSLAAPKITPSARATSASKASRLSVSQSETSYHSTRPARSSSVTRPSLSTS
QYTSFTSNRSPSTILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSSASRASTPSRIRPGSSSSSMDKPRPSLSSSRP
STPTSRPQITANSPNIVASRPNSRPSTPTRRTPSISSASATSGSNISTGRGGTNGRVTPSLSRPSSPGPRVRTTTQQPIV
LADFPLDTPPNLRTSLQGRPISAGRSRPAAGSSITAKASPEPKGPLTRRNSSPVVTRGRLTETQGKGRYGGGNGLQHHMD
APEPRRISNVADVTSRRTLKTTSTVADNNNGLGRSFSKNSLDMAIRHMDIRNGKSNGCALSTTTLFPQSIRQASSKIQPI
RSVNNLSDSISSSSAENGNEANEGRRLMGKLSDMDMYESSRYDALLLKEDVKNTNWLHSIDDRSSDHGLMFDNGGFELLP
EPFGPL*

DNA
ATGAACAGGAATCTCAGAGAGTCTCTTGCCGGTGGGAGGAACACTCCCGCGATCTCACAGTTTCGCAGAGGCAACATCTC
TCAGAATGGTTTCTCTAGAGATTCCGATGAGAATCTAGATCTCTTCTCCAAGATCCGCCGCTCGTTCCCGTTGGCTTCCT
CTGACGAATTACCCGACGTTTCTGCGAAACTCGGGAGGCTCTCTGTCGGATCCAAACCAGCTCCCAGAGGCAAAGGTGAT
GATCTGTTGTCCTCTGCTGAAGGAGGCAAAAATGATTATGACTGGCTTCTTACTCCACCTGGAACACCTCTCGGAAACGA
CTCTCATTCATCTTTGGCTGCTCCAAAGATTACACCTTCCGCTAGAGCCACCTCTGCTTCAAAGGCATCAAGGCTTTCGG
TTTCACAGTCTGAGACAAGTTACCACTCCACACGTCCAGCTAGAAGCAGCTCCGTGACTCGCCCATCCCTCTCCACCTCA
CAATACACCTCATTCACATCAAACCGCTCACCATCAACAATCCTAAACACTAGCTCAGCTTCAGTCTCATCCTACATCAG
ACCTTCATCCCCTAGCTCCCGTTCCTCGTCTTCCGCTAGACCTTCCACTCCCACCCGAACTTCTTCAGCATCACGCGCCT
CGACTCCGTCAAGAATCCGTCCCGGGTCATCTAGCTCATCCATGGACAAGCCTAGACCATCCCTAAGCAGCTCAAGACCA
TCGACTCCAACTTCTAGACCACAGATCACAGCTAACTCCCCAAACATAGTTGCTTCAAGACCAAACTCTCGTCCTTCGAC
CCCAACGCGTCGAACCCCATCCATCTCTTCTGCATCCGCAACATCAGGATCAAATATTTCAACCGGACGTGGAGGAACAA
ACGGTCGTGTCACACCTTCTTTGTCTAGGCCAAGCTCTCCTGGACCTAGAGTTCGAACCACCACGCAACAGCCGATTGTG
TTAGCAGACTTCCCTCTTGACACACCACCTAATCTCAGAACAAGTCTCCAGGGAAGACCGATATCAGCTGGCAGGTCTAG
ACCAGCAGCTGGTAGCAGCATCACGGCGAAGGCAAGTCCAGAACCAAAAGGTCCACTGACGAGAAGGAACTCATCTCCTG
TTGTGACGAGAGGAAGACTCACAGAGACTCAAGGAAAAGGCCGTTATGGTGGTGGTAATGGACTGCAACACCACATGGAT
GCACCAGAGCCTCGGAGGATTTCAAACGTTGCAGATGTAACTTCACGGAGAACCCTGAAGACTACTTCAACTGTCGCTGA
TAATAACAACGGACTTGGGAGGTCGTTCTCAAAAAATTCACTTGATATGGCCATCAGGCATATGGACATAAGAAACGGGA
AGTCAAACGGTTGCGCACTATCAACCACGACGTTATTTCCTCAGAGCATCAGACAAGCCTCGTCCAAGATACAGCCGATC
CGTTCAGTAAATAACCTTTCGGATTCTATTAGCAGTAGCAGCGCAGAGAACGGGAACGAAGCAAACGAGGGAAGAAGACT
GATGGGAAAGCTGAGCGACATGGACATGTATGAGAGCTCAAGGTATGACGCTTTGTTGCTGAAGGAGGACGTCAAGAACA
CAAACTGGTTACATAGCATTGATGATAGGTCATCAGATCACGGACTCATGTTTGATAATGGAGGATTCGAGCTTCTTCCT
GAGCCCTTTGGCCCACTATAA