Details for Chinese cabbage Locus Brara.E03143

Position : A05 ( 5`- 25825899 .. 25827070 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03143

Protein [Map View]
MGSCVSKDTGDDDSVHNVDFSGGNVHLITTKESWDEKLAEAGRDGKIVIANFSATWCGPCKIVAPFYVELSEKHPSLMFL
LVDVDELSDFSSTWDIKATPTFFFLKNGEQIGKLVGANKPELQKK

DNA
ATGGGAAGCTGCGTCTCTAAGGACACAGGAGACGATGATTCAGTTCATAACGTTGATTTCTCGGGTGGGAATGTTCATCT
GATTACAACAAAAGAGAGCTGGGATGAGAAATTAGCTGAAGCTGGTCGTGATGGCAAAATTGTGATTGCAAACTTCAGCG
CCACATGGTGCGGTCCATGTAAGATTGTGGCACCGTTTTACGTGGAGCTCTCTGAGAAACATCCTTCTCTTATGTTCCTT
CTCGTAGATGTTGATGAACTTAGTGATTTTAGCTCAACATGGGACATAAAGGCAACACCAACCTTCTTCTTCCTAAAGAA
CGGAGAGCAAATAGGCAAGCTTGTCGGAGCTAACAAGCCTGAGCTACAGAAGAAG