Details for Chinese cabbage Locus Brara.E03139

Position : A05 ( 5`- 25812688 .. 25815963 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03139

Protein [Map View]
MVLGCFPLKSKKKRGGSVSMKRLDLEESKPIALPEPPKPPSRNLQSAPPSFRTRVKPVHSSSNGEMTSRARVMSAPSSIH
GTAERDLLAGVYHEEQDEQQPKDPRSSTKEPTPQPQPLPLPSPRTGSSLKNWGSFKSFNGSSGRLSASAVSGPLPLPPSG
SVRSFSYDEVVSACSAFATDRCVSEGLSSVMYMASFGDEAASTTNLKKVEATVVRLHVVTQSIREFTNEVNTLASLQHQN
LCKLVGYHARDGSDTRMLVYERLALGSLDRLLHGRSDGPPLDWNTRMKIALCAAQGLTFLHEEGPFQAMYNEFSTANIQV
DKDFSAKLSGYGCVGHAPETETSNSSALANLSVETLERGVLTPKSNVWSYGIVLLEMLTGRKNMDGSYPKEERNLVKWSR
AFLADDCRLSLIMDPQLKGRFPAKAARSIADIAQRCLQAEPSERPTMRNIVDQLKIIQDMKYSCRFPLREPAPAAVRKHM
GRSSSLNTIVWTPGVVGAAPRSSFSPSPPARRPSVSPTRGRGLAFPPVFPARVCSSLEEMSREEVRRLSSVSGRRTSLEG
F*

DNA
ATGGTGTTAGGATGTTTCCCTTTGAAAAGCAAGAAGAAACGTGGCGGCTCGGTTTCTATGAAGAGGTTAGATCTTGAAGA
AAGCAAGCCTATTGCTTTACCAGAGCCACCTAAACCTCCAAGCCGTAATCTACAATCAGCTCCTCCTAGCTTCAGAACTA
GAGTGAAGCCAGTTCACTCCTCCAGCAACGGAGAGATGACAAGCAGGGCGAGAGTGATGTCTGCTCCTTCAAGCATCCAC
GGTACAGCGGAGCGTGATTTACTCGCAGGAGTTTACCACGAGGAGCAAGACGAACAACAACCTAAAGACCCACGCAGCTC
TACTAAAGAACCTACCCCACAACCACAACCACTTCCTCTACCGTCTCCAAGAACCGGCTCTTCGCTAAAGAACTGGGGAA
GCTTTAAATCGTTTAACGGAAGCAGCGGGAGGTTATCTGCATCAGCAGTATCCGGACCTCTCCCTTTACCACCTAGCGGC
TCTGTTAGAAGCTTCTCGTACGACGAAGTAGTCTCCGCTTGTAGCGCGTTCGCTACGGACCGATGCGTCTCCGAAGGTCT
TTCATCTGTTATGTACATGGCTTCCTTTGGCGACGAGGCTGCTTCAACTACAAACTTAAAGAAGGTCGAAGCAACTGTTG
TCCGCCTTCACGTGGTAACTCAGAGTATTAGGGAGTTTACTAATGAAGTGAACACCTTGGCGTCGCTGCAACACCAGAAT
CTATGTAAGCTGGTGGGCTATCACGCACGCGATGGATCTGACACGAGGATGCTGGTGTACGAGAGGCTTGCTCTTGGAAG
CTTGGACCGTTTGTTACACGGGAGATCAGATGGTCCTCCGCTTGATTGGAACACTAGAATGAAGATCGCTCTATGCGCAG
CTCAGGGGCTAACCTTCTTACACGAAGAAGGCCCGTTTCAGGCAATGTACAATGAATTTTCAACGGCTAACATCCAAGTG
GACAAAGATTTCAGCGCGAAGCTATCCGGATACGGCTGCGTAGGCCACGCGCCAGAGACAGAGACCTCAAACAGCTCAGC
ACTCGCGAATCTCTCGGTGGAGACGCTAGAGAGAGGAGTCTTAACACCGAAGAGCAACGTGTGGAGCTACGGAATAGTTC
TCCTCGAGATGCTAACAGGGCGCAAAAACATGGACGGCTCTTACCCTAAAGAAGAGAGAAACTTGGTGAAATGGAGCAGA
GCTTTTCTAGCCGACGACTGCAGACTCTCTCTCATAATGGACCCTCAGCTCAAAGGTCGGTTCCCCGCGAAGGCCGCGAG
GAGCATAGCGGATATAGCGCAGAGGTGTCTGCAGGCGGAGCCGTCAGAGCGTCCGACGATGAGGAACATCGTGGATCAGC
TCAAGATCATACAAGACATGAAGTACTCGTGTAGGTTCCCGTTGCGAGAACCCGCACCGGCCGCGGTGAGGAAGCATATG
GGGAGATCGAGCAGTTTAAACACGATTGTTTGGACTCCTGGGGTGGTAGGGGCTGCGCCGAGGTCGAGCTTCTCGCCGTC
GCCTCCGGCGAGACGGCCGTCGGTTTCGCCTACTAGGGGACGGGGGTTGGCGTTCCCGCCGGTGTTTCCGGCAAGAGTGT
GTTCGTCGTTGGAGGAGATGAGTAGGGAGGAAGTGAGGAGATTGTCTTCGGTCAGTGGTAGGAGAACTAGTCTTGAAGGG
TTTTGA