Details for Chinese cabbage Locus Brara.E03138

Position : A05 ( 5`- 25797144 .. 25797801 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03138

Protein [Map View]
MRSLLLALFLVLAFHRGEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIGGVSF
SSNNVNNAQSLPAKCGVNLPYSISPSTNCDSIN*

DNA
ATGAGATCTCTCTTACTAGCCTTGTTCCTAGTTCTTGCTTTCCACCGTGGTGAAGCAGCCGTGTCTTGCAACGCAGTGGT
TGGAGATCTTTACCCTTGTCTCTCCTACGTGGTTCAAGGCGGTAACGTCCCAGCGAACTGCTGCAACGGCATCAGAACGC
TCAACAGTCAGGCCCAAACCCCTGTGGACCGTCAGGGCGTTTGCCGTTGCATCAAAAATGCTATCGGAGGAGTCTCTTTC
TCTTCTAACAACGTCAACAATGCTCAGTCTCTGCCTGCTAAGTGTGGTGTGAATCTCCCTTACAGTATCAGCCCTTCCAC
CAACTGCGACAGTATCAACTGA