Details for Chinese cabbage Locus Brara.E03136

Position : A05 ( 5`- 25789913 .. 25793736 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03136

Protein [Map View]
MEEDDSVSLTLHTLASIRSLIINADTPFSVISSVLDLLTGLLPRDDSPILHHVLKLLSDLSLSRNDLAPQIFESILSNLL
RLQTSAAESLAVLASLSERNPTAAAIDGEAFATICIGADVSSRMWMLRNAERFDLPSSVLFTLCFGFTKDPYPCIRRVAL
DGLVYVCEAGGFDHARAVQGCYARAVELLDDDEDSVRSSAVRAVSVWGKVLIASKEEASRRECSDAVFLQLCSVVRDMSV
DVRVEVFKAFGVIGTASESILLQTLSKKVLRAAGKGKKPQNHLLNESADAAAAAGVFIHGFEDEFYEVRKAAVESFHSLS
VNSIEFPDEAVCLLMDMLYDDYMVVRLKALEALHHIADMGNLKIQETYIPAFLDAIVDTSENIRLTARNILKLAKLPDMK
LVNKGVDGVLKSLEMYPQDEPDILSTLFLLGQNHSNFVVNIIKRFRAKLETDSGNKSEFNSRQVSAFLMFIISAPLSNKQ
SITSIPPLAFSYSLAMLGKFSCGLHDMMDQDTLLAYLAHCTTRSASSGTEFNKADTFLNAYRRSNADHSGDPVLLPSNIP
AESKPMASKEELDPALKLVSHIQLKVKAAWLLLQSAFSKEAIRALRACKQELSTLTTNSSISNGALGFMCQYVHLIELLA
QVWPHFENSRHTSTCRSVELELLMEELEIKLMEIRCRFTGLSTEVSLVMELVILGCLLRLYKFEICCRLSCKKRLSATVS
QLELHHEQQCTKPSDFLTETKKSLQEIGSSGDISCLTLLDLIKKFNCFSPEQFTLSGNLQCVSAELEVPGNGPYNPVSFV
AGLPVAIPCEIKLLNVPRNSRLWLRISRSDDTCQFVYLDPNLYNGGETEKRFMFTAVACMTPRAVVFTLQVSIGIECLFE
DVCCRKHRYGPKHPVTYLCKEREVHFSHVSRTEAVL*

DNA
ATGGAAGAAGACGACTCCGTTTCACTCACTCTCCACACTCTAGCCTCCATTAGATCACTCATCATCAACGCCGACACTCC
CTTCTCCGTAATCTCCTCGGTCCTCGACCTCCTCACTGGTCTTCTCCCCCGAGACGACTCGCCGATCCTCCACCACGTCC
TCAAGCTCCTCTCCGATCTCTCCCTCTCGAGAAACGACTTAGCACCACAGATCTTCGAATCAATCCTCTCCAACTTGCTC
CGCCTCCAAACCTCCGCCGCGGAATCGCTCGCCGTGCTCGCGTCGTTATCCGAACGAAACCCTACCGCCGCCGCAATCGA
CGGAGAGGCGTTCGCGACGATTTGCATCGGAGCAGATGTGTCTTCTCGGATGTGGATGCTTAGGAACGCGGAGAGGTTCG
ATCTCCCGTCGTCGGTGCTCTTCACGTTGTGCTTCGGGTTCACGAAGGATCCGTATCCGTGTATCAGAAGAGTAGCTCTT
GATGGATTGGTTTATGTATGTGAGGCTGGTGGTTTCGATCACGCACGTGCCGTGCAAGGTTGTTATGCACGTGCCGTTGA
GCTTCTGGACGATGATGAAGATAGCGTCAGATCTTCTGCAGTTCGTGCCGTTAGTGTGTGGGGCAAAGTGTTGATAGCAT
CCAAGGAAGAGGCGAGTAGAAGAGAGTGTTCTGATGCTGTGTTTCTCCAGCTTTGTTCTGTTGTGAGAGATATGAGTGTA
GACGTGAGGGTTGAGGTCTTCAAGGCGTTTGGGGTGATAGGAACTGCATCAGAAAGCATTCTACTGCAAACACTTTCTAA
AAAAGTATTGAGAGCCGCCGGGAAAGGAAAGAAACCGCAGAATCATCTTTTGAATGAATCTGCTGATGCCGCTGCTGCAG
CTGGAGTTTTCATCCATGGTTTTGAAGATGAATTCTACGAGGTACGGAAAGCTGCGGTTGAGTCCTTCCACTCCCTCTCA
GTAAATTCTATCGAATTCCCAGATGAAGCTGTTTGCCTATTGATGGATATGCTATACGATGATTATATGGTTGTCAGGTT
GAAAGCTTTAGAGGCATTACATCATATAGCAGACATGGGAAACTTGAAGATACAGGAAACTTATATTCCCGCTTTTTTGG
ATGCTATTGTTGATACTTCTGAGAACATAAGACTTACGGCTAGAAACATTCTCAAATTGGCAAAGCTGCCCGATATGAAG
CTGGTCAACAAAGGTGTTGATGGTGTCCTAAAAAGTTTAGAGATGTATCCACAGGACGAACCTGATATCTTGTCTACTCT
GTTCCTTCTCGGACAAAACCATTCAAATTTCGTAGTCAATATAATTAAGAGATTTCGTGCAAAGTTGGAGACAGACTCCG
GAAATAAAAGTGAATTCAACAGCCGACAGGTGTCTGCGTTTCTGATGTTCATAATCTCAGCTCCTCTCTCAAACAAACAA
AGCATCACTTCCATACCGCCTTTGGCTTTTTCATATTCGCTTGCAATGCTGGGAAAATTCTCTTGTGGACTTCATGATAT
GATGGACCAGGATACTCTTTTGGCGTACTTGGCTCATTGCACTACTCGTTCTGCTTCTTCGGGTACAGAATTCAATAAAG
CAGATACGTTTTTAAATGCATATAGGCGCAGTAATGCAGATCATAGCGGAGACCCCGTCCTACTACCAAGCAATATACCT
GCTGAGAGCAAACCAATGGCTTCCAAAGAAGAATTGGATCCAGCACTTAAGCTTGTGAGCCATATACAGTTGAAAGTGAA
GGCTGCCTGGTTATTATTACAATCAGCATTCTCTAAAGAAGCAATCCGAGCCTTAAGGGCTTGCAAACAGGAGTTATCAA
CTTTGACAACCAATTCCTCAATCTCCAATGGTGCATTAGGATTTATGTGTCAGTACGTTCACCTAATCGAACTTCTCGCT
CAGGTATGGCCTCATTTCGAAAACTCAAGACACACCAGCACATGTAGATCTGTAGAACTGGAACTGCTGATGGAAGAGTT
AGAGATAAAACTGATGGAGATAAGGTGTAGATTCACAGGCCTGTCTACGGAGGTGTCACTTGTGATGGAGCTAGTAATTT
TAGGTTGCTTGTTAAGGCTATATAAATTTGAGATCTGCTGCCGGCTTAGCTGCAAGAAGAGGCTATCTGCAACAGTATCT
CAATTAGAGCTCCACCATGAACAACAATGCACCAAGCCATCAGATTTTCTAACCGAAACTAAGAAGTCATTGCAAGAGAT
TGGGAGCTCTGGTGATATAAGCTGCTTGACACTGCTTGATCTCATCAAGAAATTCAATTGCTTCTCCCCCGAACAGTTTA
CCCTCTCTGGTAATCTGCAGTGTGTCAGTGCAGAGCTCGAGGTTCCTGGTAATGGTCCTTACAATCCAGTTTCCTTTGTG
GCTGGACTACCAGTGGCTATACCATGCGAGATCAAGCTGCTCAACGTGCCAAGGAATTCCCGTTTGTGGCTGAGAATATC
CAGAAGCGATGACACTTGCCAGTTTGTGTACTTGGACCCAAACCTTTACAATGGAGGCGAGACAGAGAAGAGGTTTATGT
TTACTGCAGTAGCTTGCATGACCCCGAGAGCTGTTGTGTTCACACTGCAGGTCTCAATAGGCATAGAGTGTTTATTCGAA
GATGTTTGTTGCAGAAAACATCGTTATGGTCCGAAGCATCCAGTGACTTATCTGTGTAAGGAAAGAGAAGTTCACTTCTC
CCATGTTTCAAGAACAGAAGCTGTATTGTAG