Details for Chinese cabbage Locus Brara.E03129

Position : A05 ( 5`- 25715450 .. 25723165 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03129

Protein [Map View]
MALGDLMVSRFSQSSVSLASNHRYNEDDDDCVSSSAPGDSSVPSRTKDSEATTSSIYGNGTEERDATATATSMAYLPQTI
VLREVRHNASEVSAPLGTSDGIALAPKWRLKERMKTGCVALVLCLNITVDPPDVIKISPCARIEAWIDPFSMAPPKALEA
IGKNLSTQYERWQPRARYKVQLDPTLDEVRKLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKHYTQYIPLPISE
LDSWLKTPSIYVFDCSAARMILNAFAELHDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTACLTTPIKMALKW
FCRRSLLKEIIDESLIDMIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRS
ANCNPISHPMLPPTHQHHMWDAWDMAAEICLSRLPQLVRDPNTEFEPSPFFTDQLTAFEVWLDHGSELKKPPEQLPIVLQ
VLLSQCHRYRALVLLGRFLDMGSWAVDQALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQIDLVKDGGHTYF
IRFLDSLDAIPDQRAMAAFVLSVILDGHRRGQEACLEANLIGVCLGHLELSRPNDSQQEKFLQWLCLCLGKLWEDFTEAQ
IMGREANAFKKLAPLLSEPQPEVRAAAVFALGTLLDIGFGSSKSSLEDEFDDDEKIRAEEAIIKNLLDVVSDGSPLVRSE
VAVALARFAFGHKKHLKLAAASYWKPQSSSLLTSLPSIAKLHEAGNATIVSLHMSPLTRASTESQPVAREARISSSPLSS
SGLMHGSPLSDDGIMHDSVSNGAVHQQRLFDNAVYSQCVRSMFALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKTIGRL
GEAATTSNTPLAGLSRSSSWFDMHAGNMPLSFRTPPVSPPRTNYLPGLRRVCSLEFRPHLTGSPDSGLADSFLGASGSER
SLLPLSTIYNWSCGHFSKPLLSEADDSQEIDTKREEKEKFALEHIAKCQHSSISKLNNNPIANWDTRFETGTKTALLHPF
TPIVVAADENERIRVWNYEEGTLLNGFDNHDFPDKGISKLCLVNELDDSLLLVASCDGSVRIWKNYATKGKQKLVTGFSS
IQGHKPGARDLNAVVDWQQQSGCLYASGEVSTVSLWDLDKEQLVRSIPSESECGVTALSASQVHGSQLVAGFADGSLRLY
DVRSPEPLVLATRPHQKVERVVGLSFQPGLDPSKVVSASQAGDIQFLDLRTSRDTYLTIDAHRGSLTALAVHRHAPIIAS
GSAKQLIKVFSLEGEQLGRILYYPSFMGQKIGSVSCLAFHPYQVLLAAGAVDSLVSVYTHDNSPAR*

DNA
ATGGCATTAGGAGACTTGATGGTATCTCGGTTCTCGCAATCTTCCGTTTCTTTGGCCTCCAATCACCGCTACAACGAAGA
CGACGACGACTGTGTCTCCTCTTCCGCTCCCGGTGATTCGTCAGTCCCTTCGCGGACGAAAGATTCCGAGGCCACGACGA
GCAGTATCTACGGAAATGGCACGGAGGAGAGAGACGCCACCGCCACAGCCACCAGTATGGCATACTTGCCTCAGACTATC
GTGCTTCGAGAAGTTAGACACAACGCATCAGAGGTTTCTGCTCCCTTGGGGACTTCCGACGGCATTGCATTGGCTCCGAA
ATGGCGGCTTAAAGAGCGAATGAAAACAGGATGTGTAGCTCTAGTACTGTGTTTGAACATTACTGTTGATCCGCCGGATG
TTATTAAGATATCTCCGTGTGCTAGAATCGAGGCTTGGATAGATCCATTTTCGATGGCCCCGCCAAAAGCTCTCGAAGCT
ATTGGAAAAAATCTGAGCACTCAGTATGAGAGATGGCAACCAAGGGCCCGATATAAGGTTCAGTTAGATCCGACGCTCGA
TGAAGTTAGGAAGCTGTGCTTGACTTGTCGGAAATATGCAAAGACCGAGAGAGTTCTATTCCATTATAATGGGCATGGTG
TGCCAAAGCCTACAGCTAATGGTGAAATTTGGGTATTCAACAAGCATTATACACAGTACATTCCATTGCCAATCAGTGAG
CTTGATTCCTGGTTGAAGACACCGTCCATCTACGTTTTTGACTGCTCTGCTGCTAGGATGATTCTTAATGCCTTCGCTGA
GCTTCATGATTGGGGTTCTTCTGGTTCCTCTGGATCCTCAAGAGACTGCATTCTACTTGCTGCTTGTGATGTACATGAGA
CACTTCCTCAGAGCGTTGAATTTCCAGCTGATGTTTTTACTGCTTGCCTCACCACACCCATTAAAATGGCTTTGAAATGG
TTCTGCAGGCGTTCTCTGTTGAAAGAAATCATTGATGAATCACTTATTGACATGATTCCGGGCCGCCAAAATGACCGTAA
GACATTGTTAGGAGAGTTGAACTGGATTTTCACAGCAGTGACGGATACAATTGCATGGAATGTGCTTCCTCATGAACTTT
TCCAGAGATTATTCAGACAGGATTTGTTGGTCGCTAGCCTTTTCCGAAATTTCTTACTTGCTGAGAGAATAATGCGGTCC
GCAAATTGTAATCCAATATCTCACCCAATGCTGCCTCCTACGCATCAACATCATATGTGGGATGCATGGGACATGGCTGC
TGAAATCTGCCTTTCTCGCCTTCCCCAACTTGTTCGGGACCCAAACACAGAGTTCGAGCCAAGTCCTTTTTTTACTGATC
AACTGACAGCTTTTGAGGTGTGGCTTGATCATGGATCTGAGCTTAAGAAGCCACCAGAACAGTTGCCTATTGTTCTTCAG
GTGTTACTTAGCCAATGCCATCGGTATCGTGCTCTTGTACTTCTTGGAAGATTTCTTGATATGGGTTCATGGGCCGTGGA
TCAGGCTTTGTCTGTTGGAATATTCCCATATGTGCTGAAGCTTCTGCAAACAACAACAAATGAGCTAAGACAGATCCTTG
TTTTCATATGGACAAAAATTCTTGCACTTGATAAGTCATGTCAAATTGATCTTGTGAAGGATGGGGGGCATACATACTTC
ATAAGATTTCTAGATAGCTTGGATGCAATTCCAGACCAACGAGCTATGGCTGCTTTTGTTCTATCTGTCATTCTGGACGG
ACACCGACGAGGCCAGGAAGCATGTCTTGAAGCTAATTTAATTGGTGTTTGTCTGGGGCACCTTGAACTATCCAGACCAA
ATGATTCTCAGCAAGAAAAGTTTCTACAATGGCTTTGTCTTTGTCTTGGAAAGTTGTGGGAAGATTTTACGGAGGCCCAA
ATAATGGGTAGGGAGGCAAATGCGTTTAAAAAGTTGGCACCTCTTCTTTCCGAGCCCCAACCTGAGGTAAGGGCTGCTGC
TGTTTTTGCCCTGGGTACCTTACTTGATATTGGGTTTGGCTCAAGTAAAAGTTCTTTGGAAGATGAATTTGATGATGATG
AAAAGATTAGAGCAGAAGAAGCTATCATTAAAAATCTCTTAGATGTAGTTTCAGATGGGAGTCCACTTGTCCGGTCAGAG
GTTGCTGTAGCTCTTGCACGTTTTGCCTTTGGCCACAAAAAGCACCTAAAGTTAGCCGCAGCTTCATATTGGAAGCCTCA
GTCAAGCTCTTTGCTTACTTCTCTCCCCTCAATCGCTAAACTCCATGAAGCTGGGAATGCAACGATTGTTTCTTTACACA
TGAGTCCTCTGACTAGAGCTAGCACTGAAAGCCAACCAGTTGCTCGTGAGGCGAGGATCTCAAGCAGCCCTCTTAGCTCG
TCTGGGCTAATGCATGGATCTCCATTATCTGATGATGGTATCATGCATGACAGTGTCAGCAATGGAGCTGTCCATCAGCA
AAGACTGTTTGATAACGCTGTTTATTCGCAGTGCGTTCGATCTATGTTTGCATTAGCTAAAGACCCATCTCCACGAATTG
CAAGTCTCGGGCGGCGTGTGCTTTCTATCATTGGAATCGAACAAGTTGTTGCGAAACCCTCGAAGACCATTGGCCGATTA
GGGGAAGCTGCAACAACATCTAACACTCCTCTTGCTGGCTTATCTCGTTCATCCTCATGGTTTGATATGCATGCAGGTAA
TATGCCCTTAAGTTTTAGGACTCCTCCGGTCAGCCCTCCGAGAACAAACTATCTACCTGGACTGAGGAGAGTTTGTTCGT
TAGAGTTCAGGCCCCACCTGACGGGTTCACCAGACTCAGGGTTGGCTGATTCGTTTTTAGGCGCCAGTGGATCTGAACGG
AGTTTGCTCCCATTATCAACTATCTACAACTGGAGCTGTGGCCACTTTTCTAAACCGCTTCTTTCTGAAGCTGATGATAG
TCAAGAGATAGATACCAAAAGAGAAGAGAAAGAAAAATTCGCACTTGAGCATATTGCAAAATGCCAGCACTCTTCTATTA
GCAAGCTCAACAATAATCCTATTGCCAACTGGGATACAAGGTTTGAAACGGGAACAAAGACAGCCCTTCTTCACCCTTTC
ACTCCTATTGTAGTTGCTGCAGACGAGAATGAACGGATCAGAGTCTGGAATTATGAGGAAGGAACTCTTCTCAATGGCTT
TGACAATCATGATTTTCCTGACAAAGGAATTTCAAAGCTCTGCCTCGTCAATGAACTTGACGACTCTCTGCTCCTTGTTG
CGTCATGTGATGGGTCTGTCCGGATATGGAAAAACTATGCAACAAAGGGTAAACAGAAGCTTGTAACCGGATTTTCTTCA
ATCCAGGGTCACAAGCCCGGTGCACGTGACTTGAACGCTGTTGTGGACTGGCAACAACAGTCTGGCTGTCTGTATGCTTC
TGGGGAGGTGTCAACAGTCTCACTTTGGGACCTTGACAAAGAACAGCTAGTCAGATCTATTCCCTCTGAGTCAGAGTGCG
GAGTTACAGCACTTTCGGCTTCTCAAGTGCACGGGAGTCAACTTGTTGCTGGTTTCGCTGATGGATCTTTGAGACTCTAT
GATGTTCGGTCGCCTGAACCGCTTGTCCTTGCGACTCGGCCTCATCAGAAAGTTGAAAGAGTGGTTGGACTCAGTTTTCA
GCCTGGACTTGATCCCTCAAAGGTGGTGAGCGCATCACAGGCCGGTGACATACAGTTCCTAGACCTTAGAACATCAAGGG
ACACATATCTGACGATTGATGCTCACAGGGGTTCACTCACGGCCTTAGCTGTTCACAGACACGCCCCAATAATCGCGAGC
GGGTCTGCAAAACAGCTAATTAAAGTGTTTAGCCTTGAGGGAGAACAACTAGGAAGAATCCTCTACTACCCGTCCTTCAT
GGGACAGAAGATTGGTTCAGTGAGTTGCCTCGCTTTTCATCCGTACCAGGTTCTTCTTGCAGCTGGAGCTGTGGACTCGC
TCGTCTCCGTATACACTCACGACAACTCGCCAGCACGATGA