Details for Chinese cabbage Locus Brara.E03128

Position : A05 ( 5`- 25713194 .. 25714393 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03128

Protein [Map View]
MDQILNKVGSYWLGKKANKQLDSVGDDINSLSTSIEGGTKWLVNKIKGKMQKPLPELLKEFGLPVGIFPRDATNYEFNEQ
TRKLTVFIPTICEVGYKDSSVLRFTTTVTGFLEKGKLADVEGMKTKVMIWVKVTSISADSSKVHFTAGMKKSRSRDAYEV
LRDGVEIDKF*

DNA
ATGGATCAGATCTTGAACAAAGTCGGATCGTACTGGCTAGGGAAGAAGGCGAACAAGCAGCTCGATTCCGTCGGTGACGA
TATCAACTCTCTGTCTACTAGCATCGAAGGAGGAACAAAATGGCTGGTGAACAAAATCAAAGGGAAGATGCAGAAGCCAT
TACCCGAGTTACTAAAGGAGTTTGGTTTACCTGTGGGGATCTTTCCACGCGACGCAACTAACTACGAGTTCAATGAACAG
ACTAGGAAACTCACCGTCTTCATCCCAACGATCTGCGAAGTCGGCTACAAAGACTCATCGGTCTTGAGGTTCACCACGAC
GGTTACGGGGTTTTTGGAGAAAGGAAAGCTAGCTGACGTTGAAGGGATGAAAACGAAAGTCATGATTTGGGTTAAAGTCA
CGAGCATCTCTGCTGACTCTTCGAAGGTGCATTTCACGGCAGGGATGAAGAAAAGCAGAAGCCGTGATGCTTATGAGGTT
TTAAGAGACGGCGTTGAGATTGATAAGTTCTAG