Details for Chinese cabbage Locus Brara.E03123

Position : A05 ( 5`- 25698159 .. 25699278 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03123

Protein [Map View]
MAATSTAAAASSIMGTRVVSDINSGSSRFTARFGFGTKKAAAPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFG
LGKPAEYLQFDLDSLDQNLAKNIAGDVIGTRTEAADPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALSVEWLTG
VTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPEKKAQLQLAE
IKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS*

DNA
ATGGCCGCCACTTCAACAGCCGCTGCTGCTTCTTCCATCATGGGTACTCGGGTGGTTTCCGACATCAACTCCGGTTCAAG
CAGGTTCACAGCCCGGTTTGGATTCGGGACCAAGAAGGCCGCAGCTCCCAAGAAGGCTAAGACGGTTATCTCAGACCGGC
CTCTGTGGTTCCCAGGCGCGAAATCTCCCGAGTATCTCGACGGTTCGCTGGTTGGAGACTACGGTTTCGACCCTTTCGGT
TTAGGTAAACCGGCCGAGTATCTCCAGTTTGATCTTGACTCTCTGGACCAGAACTTAGCCAAGAACATAGCCGGAGACGT
GATCGGGACCCGTACCGAGGCCGCTGACCCCAAGTCAACGCCGTTTCAGCCGTACAGTGAGGTCTTTGGGCTCCAGAGGT
TCAGAGAGTGTGAGCTGATCCACGGGAGATGGGCTATGCTTGCAACTCTCGGTGCTCTCTCCGTCGAGTGGCTCACCGGT
GTTACTTGGCAAGACGCCGGCAAGGTAGAGCTAGTGGATGGATCCTCCTATTTAGGACAGCCATTACCGTTCTCTATCTC
GACATTGATTTGGATCGAAGTGTTGGTGATTGGTTACATTGAGTTCCAAAGAAACGCTGAGCTGGACTCAGAGAAGCGTT
TGTATCCAGGAGGCAAGTTCTTCGACCCGCTTGGGCTAGCTTCTGACCCGGAGAAGAAGGCTCAGCTTCAGCTGGCTGAG
ATCAAACACGCTCGTTTAGCGATGGTTGCCTTCTTGGGATTTGCGGTTCAGGCGGCTGCAACGGGTAAAGGACCGCTCAA
CAACTGGGCGACTCACCTTAGTGACCCGCTTCACACCACCATCATCGACACCTTCTCGTCCTCTTGA