Details for Chinese cabbage Locus Brara.E03121

Position : A05 ( 5`- 25691823 .. 25693999 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03121

Protein [Map View]
MASALCRTASRLRPVQLCYRFRAVSDLLSPSSPSPACISDHGDFSLHRSFFSLSGGIERLKMDQRRLLSTSASGTTSKPS
SGESEAKSSGENEKSGGSEGSDGGGSDQKSDRASGKHARGAPVSWMSFFLLFATGAGLVYYYDREKKRHIEDINTNSKAV
KEGPSAGKAAIGGPFSLVRDDGKRITEKDLMGKWTILYFGFTHCPDICPDELIKLAAAIDKIKEKAGVDVVPVFISVDPE
RDTVQQVHEYVKEFHPKLIGLTGTPEEIKSVARSYRVYYMKTEEEDSDYLVDHSIVMYLMSPEMNFVKFYGKNHDVDSLT
DGVVKEIRQYRK*

DNA
ATGGCGTCTGCTCTATGTAGAACTGCAAGCCGTCTTCGTCCCGTGCAGCTTTGTTATCGATTTCGCGCCGTAAGCGATCT
ACTGTCCCCGTCGTCTCCGTCTCCGGCGTGCATCTCCGATCATGGAGATTTCTCTCTTCACCGATCGTTTTTCTCACTTA
GCGGTGGAATCGAACGGTTGAAGATGGATCAGAGACGTTTGCTGAGCACTTCTGCTTCTGGTACAACCTCTAAGCCTAGC
TCTGGCGAATCGGAAGCGAAATCTTCCGGTGAAAACGAGAAATCTGGTGGATCCGAGGGTTCAGATGGCGGCGGTTCCGA
TCAGAAAAGCGACCGCGCGTCTGGGAAACACGCGCGTGGAGCGCCGGTTTCGTGGATGAGCTTCTTCTTGCTGTTTGCTA
CTGGAGCTGGATTGGTCTACTACTATGATCGGGAAAAGAAACGTCACATCGAAGATATAAATACCAATTCTAAAGCGGTC
AAGGAGGGACCATCAGCTGGGAAAGCAGCTATTGGAGGACCATTCAGCCTTGTAAGAGATGATGGGAAACGTATCACGGA
GAAAGACTTGATGGGAAAATGGACAATCTTATACTTTGGGTTCACTCATTGTCCTGATATCTGTCCTGACGAGCTTATTA
AGCTAGCTGCTGCCATTGACAAAATAAAGGAAAAGGCAGGAGTAGATGTGGTGCCGGTGTTTATCTCTGTGGATCCTGAA
AGAGACACAGTTCAACAAGTACATGAATATGTCAAAGAGTTTCATCCGAAATTGATCGGTCTGACCGGGACCCCTGAAGA
AATCAAATCGGTGGCTCGTTCTTACCGGGTTTACTACATGAAGACGGAAGAGGAAGATTCAGACTATCTCGTTGATCACT
CTATAGTCATGTACTTGATGAGTCCAGAGATGAATTTTGTGAAATTCTACGGGAAGAATCATGACGTTGACTCGTTGACC
GACGGTGTTGTAAAAGAGATTCGACAGTACCGGAAGTGA