Details for Chinese cabbage Locus Brara.E03120

Position : A05 ( 5`- 25684632 .. 25691073 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03120

Protein [Map View]
MALSASDLPAMYSLLANSMSGDENVRRPAEAALAQSESRPGFCSCLMEVIASKDLVSHVDVRLMASVYFKNSINRYWKSR
RNASGISNEEKIHLRQKLLSHLREENYKIAEMLAVLISKIARFDYPKEWPDLFSVLAQQLHSADVLASHRIFMILFRTLK
ELSTKRLTADQRNFAEISSQLFDFCWHLWQTDVQTILRGFSTMVQSYGSNSAEQHHDELFLTCERWFLCLKIVRQLIISG
FQSDAKSIQEIKPVKDVSPVLLNAAQSFLPYYSSFHNRDPKFWEFVKKACVKLMKVLAAIQSRHPYSFGDKCVLPVVLDQ
ILSTCTSVILGGDKDLTEEESSGEMSSGRSQGEEAPPSKELRKSQIKVSDPVYQMSLENSMRENLQTCSTLHGDAFNSAI
SRMHPSELAQVKQALKLP*

DNA
ATGGCGTTGTCAGCTTCCGATTTACCGGCTATGTACTCATTGCTAGCGAACTCTATGAGCGGCGACGAGAACGTTCGGCG
GCCGGCGGAGGCGGCTCTGGCTCAGTCGGAGAGCAGGCCTGGATTCTGCTCCTGCCTCATGGAAGTGATTGCATCTAAGG
ATTTGGTGTCTCATGTGGACGTTAGATTGATGGCGTCTGTGTATTTCAAGAACAGTATCAACCGTTATTGGAAGAGCAGA
CGAAATGCTTCGGGTATAAGCAACGAGGAGAAGATTCATCTGAGGCAGAAGCTGTTGTCTCACTTGCGAGAAGAGAACTA
CAAGATAGCGGAAATGCTGGCTGTTCTCATTTCGAAGATAGCCCGCTTTGACTATCCTAAGGAATGGCCTGACCTCTTTT
CGGTACTAGCGCAACAGCTTCACTCGGCTGACGTTCTTGCTTCTCACAGAATCTTTATGATCCTTTTCCGAACCCTGAAG
GAATTGTCTACTAAACGTCTCACGGCAGATCAGAGAAATTTCGCTGAGATCTCGTCGCAACTCTTCGACTTTTGTTGGCA
CCTCTGGCAAACTGATGTCCAAACAATTCTACGTGGCTTTTCAACAATGGTTCAGAGCTATGGTTCAAATAGTGCTGAGC
AGCATCACGATGAGCTTTTCCTGACTTGTGAGAGGTGGTTTTTATGTTTGAAAATAGTGCGACAACTCATAATCTCAGGA
TTTCAAAGCGATGCCAAAAGTATACAGGAGATTAAACCAGTGAAAGATGTCTCTCCTGTGCTCTTGAACGCTGCTCAATC
ATTTCTTCCATATTATTCATCTTTTCATAATCGAGATCCTAAATTCTGGGAATTTGTAAAGAAGGCATGTGTCAAGCTGA
TGAAAGTGTTAGCCGCAATTCAAAGCAGACATCCTTATTCATTTGGAGATAAATGTGTTCTTCCAGTCGTACTTGATCAA
ATACTAAGTACATGCACCAGTGTAATCCTTGGTGGAGATAAAGATCTAACAGAAGAAGAATCAAGCGGTGAAATGAGCTC
AGGCAGGTCTCAAGGAGAAGAAGCCCCACCTAGCAAAGAGTTGCGGAAAAGTCAGATAAAAGTTTCAGATCCAGTTTACC
AAATGTCACTGGAGAACTCAATGCGTGAGAATCTTCAGACATGTTCTACGCTTCATGGAGATGCCTTCAATTCTGCCATA
AGTAGGATGCACCCATCAGAGCTTGCACAAGTGAAGCAAGCCTTAAAACTGCCGTGA