Details for Chinese cabbage Locus Brara.E03118

Position : A05 ( 5`- 25679458 .. 25681103 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03118

Protein [Map View]
MGIQNLLWQVTKKAFTGGIIGVTISDRCCSVVPVRGDSMSPTLNPQRNSYLDDYVLVEKFCLQDYKFVRGDVVVFSSPTH
FKDKYIKRIVGLPGEWISSSRDVIRVPEGHCWVEGDNKASSLDSRTFGPIPLGLIRGRVTSVVWPPQRVSKIS*

DNA
ATGGGAATCCAAAATCTTTTATGGCAAGTGACGAAGAAAGCATTCACTGGAGGTATCATAGGGGTTACTATTTCAGATAG
ATGTTGTAGCGTTGTTCCCGTGAGAGGAGATTCCATGTCTCCCACTTTGAATCCCCAGAGAAATTCTTATTTAGATGATT
ATGTTTTGGTAGAGAAATTTTGCCTTCAGGATTACAAGTTTGTGCGTGGTGATGTTGTAGTGTTCAGCTCTCCCACTCAT
TTCAAGGATAAATACATAAAGAGGATAGTGGGGCTGCCTGGGGAATGGATAAGTAGTTCACGGGATGTGATCAGAGTCCC
AGAAGGACATTGTTGGGTAGAAGGAGATAACAAAGCTTCCAGCTTAGACTCAAGAACCTTTGGCCCTATTCCTTTGGGTT
TAATTAGAGGACGGGTGACTAGTGTCGTGTGGCCTCCTCAAAGAGTAAGCAAGATTAGTTGA