Details for Chinese cabbage Locus Brara.E03116

Position : A05 ( 5`- 25674099 .. 25676688 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03116

Protein [Map View]
MLTHDRDEELSMFLEMRRRDKERRGESLLTGSDSTSINGALTTAAAAALSGVSETVSSQRYPLRRTAAENFLYSENEKSD
YDWLLTPPGTPQFEKESHRSIMEQSEAPNSRPTNLKSRLGNYREDIVSGNNNKSQMSSSSSVAGLRRPSSSSSSRSTSRP
STPTRRSTTPTPTTTTSTTRPVTTTRASNSRSSTPTSRATLTAARATTSTAAPRTTTSRSATPTRTKTQPSSAPSKKPLS
RSATPTRRSPTPTGPSIVSSKAPSRGTSPTPTPTGPSMVSSKAPSRGTSPTPTVKSSKPWKPREMPGFSLEAPPNLRTSA
SDRPVSATRGRPGVASAPGSRSNSIERGNGAASNGVGHARRQSCSPSRGRAPVGSTNGSLPGARGRGKANNGDSPVAMGN
KMVERVVNMRKLGPPRLTESGGRGTAKSSSAFNSLGYGRNLSKSSIDMALRHMDIRRGMTGNLRPLVTKVPASSMYSVRS
RSNSVTNSPMATSSTVSSSEPNLDNINILCLDGNDAENDDLLSERSFSSPRDQFPKFTS*

DNA
ATGTTGACACACGACAGAGATGAAGAACTCTCTATGTTCCTTGAGATGCGTCGACGCGACAAAGAACGTAGAGGAGAATC
TCTTTTAACAGGATCTGATAGTACTAGTATCAACGGAGCGTTGACGACTGCTGCTGCTGCGGCGCTCTCTGGTGTATCCG
AAACGGTGTCGTCTCAACGTTATCCTCTCCGGAGAACCGCAGCAGAGAACTTCTTGTACTCAGAGAATGAGAAATCCGAT
TACGATTGGCTGCTTACGCCTCCTGGAACGCCGCAGTTTGAGAAAGAGTCACATAGGAGCATAATGGAACAGAGTGAGGC
TCCCAATTCTCGCCCCACGAATCTTAAATCTCGGCTAGGGAACTACCGTGAAGATATCGTCTCAGGGAACAATAACAAGT
CCCAAATGTCATCGTCCTCCTCTGTAGCTGGACTCAGAAGACCATCTTCATCAAGTAGCTCAAGGTCGACGAGCAGACCT
TCTACACCAACTAGAAGGTCTACAACCCCAACCCCAACCACAACCACCTCTACAACAAGGCCTGTGACAACCACTAGAGC
TTCAAACTCTAGATCCTCAACACCCACCTCACGTGCAACATTAACTGCTGCACGTGCTACTACCTCCACAGCAGCTCCAC
GCACCACAACATCTAGATCAGCTACTCCAACTCGGACTAAGACTCAGCCTTCTTCTGCACCTTCTAAAAAACCTTTATCA
AGGTCGGCCACGCCAACCCGCAGGTCTCCAACCCCGACCGGTCCATCAATAGTTTCGAGTAAAGCTCCCTCTCGAGGGAC
TTCTCCAACTCCAACCCCGACCGGTCCATCAATGGTTTCTAGTAAAGCTCCCTCTCGAGGGACTTCTCCCACTCCAACTG
TGAAGTCGTCGAAGCCATGGAAGCCGCGGGAGATGCCTGGATTCTCATTAGAAGCCCCACCGAATCTGAGGACCTCTGCA
TCAGATAGACCAGTCTCAGCTACAAGAGGCAGACCTGGAGTAGCCTCTGCACCAGGCTCAAGATCAAATTCCATAGAACG
TGGCAACGGCGCCGCCAGTAATGGTGTCGGACACGCAAGAAGACAATCTTGCTCCCCGTCGAGAGGCCGTGCACCTGTAG
GGAGCACCAACGGGAGCCTCCCAGGTGCACGTGGGCGAGGAAAGGCCAACAACGGCGATAGCCCAGTGGCTATGGGTAAT
AAAATGGTCGAGAGAGTGGTGAACATGAGGAAACTAGGTCCACCACGGCTAACAGAGAGCGGTGGTAGAGGAACGGCCAA
ATCTAGCTCTGCTTTTAACAGCCTTGGCTATGGGAGAAACCTCTCCAAGAGCTCCATCGATATGGCCTTAAGACATATGG
ATATAAGACGAGGCATGACAGGGAATCTCCGGCCGCTTGTCACGAAAGTTCCGGCATCATCAATGTACAGCGTGCGAAGC
CGGTCGAATAGTGTCACCAACTCTCCGATGGCTACGAGCAGCACTGTCAGCTCATCCGAACCGAACTTGGACAACATCAA
CATTTTGTGCTTAGATGGGAACGATGCTGAAAACGATGATCTTCTTAGCGAGAGAAGCTTTTCTTCTCCGCGAGACCAGT
TCCCTAAGTTCACATCTTGA