Details for Chinese cabbage Locus Brara.E03115

Position : A05 ( 5`- 25669709 .. 25670929 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03115

Protein [Map View]
MDSEIAKKVTAVFDHRRLNRSGSSLFTAFAASVIALIVFTVVIVSNLTVRDISEVVKIEIKTVVPYLPLRSERELSAGKN
NYTIKQITTVKENNNLEILETFGGKGVSEKFQQRATEFLRDDCEVSFMMTWISPVDKFGKRDVLSVESVFKSHPRGCLII
LSSTMDSPRGFRVLKPFLDRGYRVTAVTPDLPFLLKDTAGESWLEEIKTGKRDPGKISLAQNLSNLMRLAYLFKFGGVYL
DTDMIVLKSFKPLRNVIGAQTLEPVSRNWTRLNNAVLVFDKSHPLLRKCIEEFALTFNGNVWGHNGPYLVSRVARAVEGT
VGYNFTVMTPPAFYSVNWIEIGKLFKVPRTEKDRKRVEVKVLEMQRRSYGLHLWNKFSSKFQIEKGSAMDKIVSDHCVIC
EKVSVS*

DNA
ATGGATAGTGAAATAGCTAAAAAAGTCACGGCGGTGTTTGATCACCGGCGGTTAAACCGCTCCGGTTCATCACTGTTCAC
AGCCTTTGCTGCCTCAGTAATAGCTCTGATCGTTTTCACGGTCGTCATCGTATCCAACTTAACGGTGAGAGATATCTCGG
AGGTGGTGAAGATAGAGATCAAGACCGTTGTTCCTTACTTACCTCTGAGATCAGAGAGAGAGCTGAGCGCTGGCAAGAAC
AACTACACGATCAAGCAGATTACCACAGTTAAAGAGAATAACAATCTCGAGATTCTCGAGACTTTTGGAGGCAAAGGCGT
GTCGGAGAAGTTTCAGCAAAGAGCAACAGAGTTTCTGAGAGATGATTGTGAAGTCAGTTTCATGATGACGTGGATCTCGC
CTGTTGATAAGTTCGGTAAGAGAGATGTTTTGTCTGTGGAAAGCGTTTTTAAATCACATCCTCGTGGTTGTTTGATCATT
TTATCATCTACGATGGATTCTCCTCGAGGGTTTAGAGTCTTGAAACCGTTTCTTGACCGCGGTTACAGAGTTACTGCGGT
AACTCCTGATTTACCTTTTCTCCTCAAGGACACGGCGGGAGAGTCGTGGCTTGAGGAGATTAAGACAGGGAAGAGAGATC
CCGGGAAGATCTCTTTAGCTCAGAACCTCTCAAACCTCATGAGACTCGCGTACTTGTTCAAGTTCGGGGGCGTTTATTTG
GACACGGACATGATAGTGCTGAAAAGTTTTAAGCCTCTGAGGAACGTGATCGGTGCGCAGACTCTCGAGCCGGTTTCGAG
AAACTGGACGAGGCTGAACAACGCGGTTTTGGTCTTCGACAAGAGCCACCCTCTCTTGAGGAAATGTATCGAAGAGTTTG
CGTTGACTTTCAACGGTAACGTTTGGGGTCATAACGGACCGTATCTTGTTTCACGAGTGGCTAGAGCTGTTGAGGGAACG
GTTGGTTATAACTTCACCGTCATGACGCCTCCTGCGTTTTATTCGGTTAATTGGATTGAGATTGGGAAGCTCTTCAAGGT
TCCGAGAACCGAGAAGGATAGGAAGAGAGTGGAAGTCAAGGTTCTTGAGATGCAGAGGAGAAGCTACGGGTTGCATTTGT
GGAATAAGTTTAGTAGTAAATTTCAAATTGAGAAAGGTAGTGCCATGGATAAAATCGTTTCGGATCATTGTGTGATCTGT
GAGAAAGTCTCTGTATCATAA