Details for Chinese cabbage Locus Brara.E03110

Position : A05 ( 5`- 25656149 .. 25657201 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03110

Protein [Map View]
MMNTLQAFQTTLTPNFHVLFNPPRHSISRTQFLCLSKPRDGNSDSESDPDPPKPEGDTQRQELLARIAMLQTSKVRLTDF
LDERSDYLTKFAEEANAEFDKVGEDAMKDLDEASSRILENIESKMQAFEESAGLNRLEIEENDNKLVEFEEQIVEDRNEG
LFFKSLRDKQPVDVEKAKEETKKIQEVTKESAGSESRRNIYLGLIGIVALGIADSFASSPDWRKVAVLGAILIPLLTQFV
NEQTLLSEEADKGKGNKKE*

DNA
ATGATGAACACACTTCAAGCATTTCAGACAACTCTAACACCAAACTTCCATGTTCTATTCAATCCCCCAAGACATTCCAT
TTCTCGAACCCAATTCCTCTGTCTCTCGAAACCCAGAGATGGAAACTCGGACTCAGAGTCTGATCCCGATCCTCCAAAAC
CAGAAGGAGATACACAGAGACAAGAGCTCTTAGCCAGGATCGCCATGCTTCAAACATCAAAGGTCCGTTTAACCGATTTC
TTGGACGAACGATCGGATTACCTCACCAAGTTTGCTGAAGAAGCCAACGCTGAGTTTGACAAGGTTGGAGAAGACGCCAT
GAAAGACCTCGACGAAGCAAGCTCAAGGATACTAGAGAACATCGAGAGCAAGATGCAAGCATTCGAGGAATCTGCAGGGT
TGAACAGGTTGGAGATAGAGGAGAACGATAACAAGTTGGTTGAGTTTGAGGAGCAGATCGTGGAAGACAGGAACGAAGGA
TTGTTCTTCAAGAGCTTACGTGATAAACAGCCTGTTGATGTAGAGAAAGCTAAAGAGGAGACTAAGAAAATACAAGAGGT
TACCAAAGAGAGTGCAGGATCAGAGTCAAGAAGGAACATTTACCTCGGTTTGATTGGGATCGTGGCTCTAGGAATCGCTG
ATTCGTTTGCTTCTTCACCGGATTGGAGAAAAGTAGCTGTTCTTGGAGCTATCCTTATCCCACTGCTCACTCAGTTTGTG
AACGAGCAGACATTGTTATCAGAAGAAGCAGATAAGGGTAAAGGAAACAAGAAAGAATGA