Details for Chinese cabbage Locus Brara.E03109

Position : A05 ( 5`- 25651588 .. 25656148 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03109

Protein [Map View]
MKTHTRRCLLRFFLFLILSNPSYGENKFRERKATDDEQGYPEIDEDALLNTQCPRKLELRWQTEVTSSVYATPLIADINS
DGKLDIVVPSFVHYLEVLEGADGDKMPGWPAFHQSNVHSSPLLFDIDKDGVREIALATYNGEVLFFRVSGFLMSDKLEVP
RRKVHKNWHVGLNPDPVDRSHPDVHDEQLVQEAMEMKSATTQTHATTTTPNVTVSMPKEFHGEASNVTSQEDQKKPENNQ
TEAVVKPTQVTSQEDQKKPENNQTEAVVKPTPVTSQEDQKKPENNQTEAVVKPTPELHNSSMNVSSNNSATNDTTAVSTE
KTSGNVTTKEVDQSKISEAKNDTVIKLNTSTDNSSETLVTSGNSSTTKTGTKSGRRLLEDGGSDGHSDNKDNNEGVRMAT
VENDGILEADADSSFDLLRDTEELGDEYSYDYDDYVNETMWGDEEWVEGQHENSEDYVNIDAHILCTPVIADIDKDGIQE
MVVAVSYFFDPEYYDNPEHLKELGSIDIKNYIASSIVVFNLETKQVKWVKELDLSTDNSNFRAYMYSSPTVVDLDGDGYM
DILVGTSFGLFYAMDHRGNIREKFPLEMAEIQGAVVAADINDDGKIELVTTDSHGNVAAWTTQGVEIWEVHLKSLVPQGP
SIGDVDGDGHTDVVVPTTSGNIYVLSGKDGSIVRPYPYRTHGRVMNQLLLVDLNKRGEKKKGLTIVTTSFDGYMYLIDGP
TSCADAVDIGETSYSMVLADNVDGGDDLDLIVSTMNGNVFCFSTPSPHHPLKAWRSTDQGMNNKAIRYDREGVFVTHSTR
GFRDEEGKNFWAEIEIVDNYRYPSGSQAPYNVTTTLLVPGNYQGDRRIKQSQIYNKPGKYRIKLPTVGVRTTGTVMVEMV
DKNGLHFSDEFSLTFHMYYYKLLKWLLVLPMLGMFGLLVILRPQEAVPLPSFSRNRD*

DNA
ATGAAAACCCACACGCGACGGTGTCTGCTGAGGTTTTTCCTCTTCCTGATCTTATCGAATCCCTCTTATGGGGAAAACAA
GTTCAGAGAGCGTAAAGCCACCGATGACGAGCAAGGCTACCCCGAAATTGATGAAGATGCTTTGTTGAATACTCAGTGCC
CGAGGAAACTGGAGCTGCGATGGCAAACTGAAGTCACTTCTAGCGTTTATGCTACACCTTTGATTGCTGATATCAACAGT
GATGGAAAGCTTGACATTGTTGTTCCATCTTTTGTTCACTACCTTGAAGTTCTTGAAGGTGCTGATGGAGACAAGATGCC
AGGTTGGCCTGCTTTTCATCAGTCAAACGTGCATTCAAGTCCTCTTCTATTTGATATCGACAAAGATGGTGTTAGAGAAA
TAGCTCTGGCGACCTACAATGGCGAAGTGCTCTTTTTCAGGGTATCAGGCTTTTTGATGTCAGATAAGCTAGAAGTGCCA
CGTAGAAAAGTGCACAAGAACTGGCATGTGGGTCTGAATCCTGACCCTGTTGACCGTTCACATCCTGATGTCCATGATGA
ACAGCTTGTGCAAGAAGCTATGGAGATGAAGTCAGCGACCACTCAAACGCATGCAACTACCACAACACCAAATGTTACAG
TCTCGATGCCCAAAGAATTTCATGGCGAGGCTTCAAATGTGACGTCACAAGAGGATCAGAAGAAACCAGAAAATAACCAA
ACAGAAGCAGTCGTAAAGCCTACTCAAGTGACGTCTCAAGAGGATCAGAAGAAACCCGAGAACAACCAAACCGAAGCAGT
CGTAAAGCCTACCCCAGTGACGTCTCAAGAGGATCAGAAGAAACCTGAGAATAACCAAACAGAAGCAGTTGTAAAGCCTA
CTCCAGAGCTACATAACTCCTCCATGAATGTTAGCTCGAACAATTCGGCAACAAATGATACTACAGCTGTCTCAACAGAA
AAAACCAGTGGAAATGTAACCACCAAAGAGGTGGATCAAAGCAAGATTAGTGAAGCTAAGAATGACACTGTTATTAAATT
AAATACCAGTACGGATAATTCTTCAGAAACTTTGGTGACATCTGGAAACAGTAGTACGACAAAGACAGGAACCAAAAGTG
GGAGGCGACTTCTGGAAGATGGTGGCTCGGACGGCCATTCTGACAATAAAGACAACAATGAGGGTGTTCGCATGGCCACA
GTTGAAAACGATGGAATATTAGAAGCTGACGCAGATTCATCGTTTGACTTGTTGCGTGATACAGAGGAGTTAGGTGATGA
ATACAGTTATGATTATGACGATTATGTTAATGAGACCATGTGGGGTGATGAGGAATGGGTCGAGGGGCAGCACGAGAACT
CAGAGGATTATGTGAACATTGACGCCCATATACTGTGCACTCCTGTTATTGCTGACATAGACAAAGATGGAATACAGGAG
ATGGTTGTTGCTGTTTCCTATTTCTTCGACCCTGAGTATTATGACAATCCAGAACATCTGAAAGAGCTTGGTAGTATTGA
CATCAAAAACTACATTGCTAGTTCAATTGTGGTTTTCAATCTTGAGACTAAACAAGTTAAATGGGTCAAAGAGCTAGATT
TGAGTACGGATAACTCAAACTTCCGTGCATATATGTATTCTTCCCCAACGGTTGTTGATTTGGATGGCGATGGTTACATG
GATATCCTTGTCGGAACTTCTTTTGGCTTATTCTACGCCATGGACCACCGTGGAAACATCAGAGAAAAATTCCCACTTGA
AATGGCTGAAATACAAGGGGCAGTGGTTGCAGCTGATATAAATGACGATGGAAAGATTGAACTTGTGACAACAGATTCCC
ACGGAAATGTAGCAGCATGGACCACCCAAGGAGTGGAAATTTGGGAAGTACATCTAAAGAGTCTTGTTCCCCAGGGTCCT
TCAATAGGCGATGTTGATGGTGATGGACATACTGATGTTGTGGTTCCTACAACATCAGGAAACATTTACGTTCTTAGTGG
CAAGGATGGTTCGATTGTCCGTCCTTACCCGTACAGAACTCATGGAAGAGTGATGAACCAGCTTCTTCTTGTTGATCTGA
ACAAGCGAGGTGAGAAGAAGAAGGGACTCACCATTGTTACCACATCCTTTGATGGTTACATGTATCTCATAGATGGACCC
ACCTCATGCGCTGACGCTGTTGATATTGGTGAAACTTCATACAGCATGGTCTTGGCTGATAATGTTGACGGTGGAGATGA
TCTTGATCTCATCGTCTCAACTATGAACGGGAACGTCTTTTGCTTCTCCACGCCTTCTCCTCACCATCCCCTCAAGGCTT
GGAGATCGACTGATCAAGGCATGAACAATAAGGCAATCCGTTACGATCGTGAAGGTGTTTTTGTCACGCATTCAACCAGA
GGTTTCCGCGATGAGGAAGGCAAAAACTTCTGGGCTGAGATTGAGATTGTTGATAACTACAGATACCCATCAGGTTCACA
AGCACCCTACAACGTTACAACGACGCTGTTGGTACCAGGCAATTACCAAGGAGACAGGAGGATAAAGCAGAGCCAGATCT
ATAACAAACCAGGAAAATACAGAATAAAACTACCAACCGTTGGAGTCAGGACAACAGGGACAGTAATGGTTGAGATGGTG
GACAAGAATGGACTCCATTTCTCAGACGAATTCTCTCTAACTTTCCATATGTATTATTACAAGCTTCTGAAGTGGCTGCT
TGTCCTCCCGATGCTGGGGATGTTCGGCCTGCTCGTGATACTACGACCTCAAGAAGCTGTCCCCCTCCCGTCCTTTTCCC
GCAACAGAGACTAG