Details for Chinese cabbage Locus Brara.E03104

Position : A05 ( 5`- 25631433 .. 25633766 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03104

Protein [Map View]
MEFGSSFGRCFKAAKPHLLISTSSKNTNIITLSSRNQRVSFRVSAVSYKEFAESALEETRKRVLLEPSPLQERYSSMTGH
DGKTQLQILALKFPKIRLLRSMAIENETMQVFDFAGFMKPEYDTPIFCANFFTSANMNIVVLDLNPLHQLTDHTNYRDKY
YKNIMSIYHKYAEIFPWGGKLTGESIKFFSPLVMWTRFSSSQEKHNALFSAFLEYYQVWLEMTIQVKEEMEPSQVRANRE
AQHKYLTWRAQKDPGHALLRKLLGEAKAKALLREFLFNGVDELGTKTFIDYFPEYETEGGTVSDKRSIIGKSFETRPWDS
NGQFIG*

DNA
ATGGAGTTTGGATCTTCATTTGGGAGGTGCTTCAAGGCAGCAAAACCTCATCTACTTATCTCTACAAGCTCTAAGAACAC
CAATATCATCACGTTGAGTAGTAGAAATCAGAGAGTCTCATTCAGAGTCTCTGCTGTTTCGTATAAGGAATTCGCCGAGT
CTGCTCTGGAAGAAACCAGGAAGAGGGTTCTTCTTGAACCTTCACCTCTCCAGGAAAGGTATAGTAGCATGACAGGACAT
GATGGGAAAACTCAACTTCAAATACTTGCTTTGAAATTTCCAAAGATTAGACTCTTGCGGAGCATGGCCATCGAAAACGA
GACCATGCAGGTATTTGACTTTGCTGGTTTCATGAAGCCAGAGTATGATACGCCCATATTCTGTGCTAACTTCTTCACAT
CTGCCAACATGAACATAGTTGTCTTGGATCTAAACCCTTTGCATCAATTGACTGACCATACGAATTACCGAGACAAGTAT
TACAAAAACATTATGTCCATATATCACAAATATGCTGAGATTTTCCCATGGGGAGGAAAACTGACCGGTGAATCCATAAA
GTTCTTTTCGCCTTTGGTGATGTGGACCAGGTTTTCTTCTAGCCAAGAAAAACATAACGCTTTGTTCTCTGCCTTCCTTG
AATACTATCAGGTATGGCTTGAGATGACAATCCAAGTGAAAGAGGAGATGGAGCCATCTCAGGTGAGAGCCAACCGTGAA
GCACAGCACAAATACCTGACTTGGCGAGCACAAAAGGATCCTGGACATGCTCTTCTTAGGAAACTGCTTGGTGAAGCAAA
GGCAAAGGCGTTGCTGAGAGAGTTCCTGTTCAATGGAGTGGATGAGTTGGGCACAAAAACATTCATTGATTACTTTCCAG
AGTACGAGACAGAAGGTGGAACTGTGAGTGATAAACGAAGCATCATTGGCAAGTCTTTTGAAACTCGGCCTTGGGATTCA
AATGGACAATTCATTGGCTGA