Details for Chinese cabbage Locus Brara.E03103

Position : A05 ( 5`- 25630253 .. 25631310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03103

Protein [Map View]
MFKPMSFDKEVELFGDSKLINEGSSIQLTNSVSGSEGRVVYKQPINLSNSLSFSSYFSFSMPNETDDVMAFVMVPTSLDL
DLFGNKNNSSSALGFLFEHAKNETVVAFEFDISKRGNRARILLGKPESSEVRNLSFEGDLLMMENGGSTLSCMIDYEASL
KRMMVRFRKLGTRKMLDPFFDFSVDLGELWNGGEFMVGLSSTNGNSSEEHVLHSWSFDIRHPTPVCVPPPMWMHPQPSDT
SKR*

DNA
ATGTTCAAACCTATGAGTTTCGACAAGGAAGTTGAACTTTTTGGAGATTCGAAGCTGATCAACGAAGGCTCTTCGATTCA
GCTGACAAACTCGGTGAGTGGAAGCGAGGGAAGAGTGGTGTACAAGCAACCCATCAATCTTAGTAACTCGCTATCTTTCT
CGAGTTACTTCTCGTTTTCCATGCCTAATGAGACCGATGACGTCATGGCTTTTGTAATGGTTCCAACTAGTTTGGATCTT
GATCTCTTCGGTAATAAAAACAACAGTTCATCTGCCTTAGGGTTTCTTTTTGAGCATGCAAAGAACGAGACGGTTGTGGC
TTTTGAGTTTGATATTTCCAAAAGAGGAAACCGTGCGAGAATCTTGTTAGGTAAGCCTGAATCTTCTGAAGTTAGAAACC
TTTCGTTTGAGGGTGACTTGTTGATGATGGAGAATGGAGGGTCGACGTTGAGCTGTATGATTGATTATGAGGCGAGTTTG
AAGAGAATGATGGTTCGGTTCAGAAAATTAGGTACGAGGAAGATGTTGGATCCGTTCTTTGATTTCTCTGTAGACTTGGG
GGAGCTATGGAATGGTGGTGAGTTCATGGTGGGTTTAAGCTCTACAAACGGGAACTCTTCCGAGGAACATGTTCTCCATT
CATGGAGCTTTGACATAAGGCATCCAACGCCGGTGTGTGTGCCTCCTCCAATGTGGATGCATCCTCAACCGAGTGACACT
TCTAAGAGGTAA