Details for Chinese cabbage Locus Brara.E03102

Position : A05 ( 5`- 25628126 .. 25629833 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03102

Protein [Map View]
MVKATKAEKKIAYDAKLCQLIDEFTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVKIHAENTGNTGILNL
MPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAAP
HMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKFAVAVAAVSADAGGGASAGAAKVEEKKEVVEESDEEDYGGFDMF
GDE*

DNA
ATGGTGAAGGCAACAAAGGCAGAGAAGAAGATCGCTTACGACGCGAAGCTATGTCAGCTCATCGACGAGTTCACACAGAT
CTTGGTCGTTGCAGCCGACAACGTGGGGTCGACTCAGCTCCAGAACATCAGGAAGGGTCTTCGTGGAGACTCAGTGGTGC
TCATGGGGAAGAACACTATGATGAAGCGTTCTGTTAAGATTCACGCTGAGAACACTGGAAACACTGGCATCCTCAATCTC
ATGCCCCTTCTTCAGGGAAATGTTGGTTTGATCTTCACCAAGGGTGACCTCAAGGAAGTAAGTGAGGAAGTTGCCAAGTA
CAAGGTTGGTGCTCCTGCTCGTGTGGGTTTGGTTGCACCTATTGATGTGGTTGTCCAACCTGGTAACACTGGTCTTGACC
CATCTCAGACATCTTTCTTCCAGGTTCTTAACATCCCAACTAAGATTAACAAGGGAACAGTCGAAATCATTACCCCTGTT
GAGCTCATCAAGCAAGGTGACAAGGTCGGTTCTTCCGAGGCTGCCCTTCTAGCCAAGCTTGGCATCAGGCCGTTCTCTTA
CGGTCTTGTTGTCCAGTCTGTTTACGACAATGGTTCAGTCTTCAGCCCTGAGGTTCTTGATCTTACGGAAGATGACCTTG
TTCAGAAGTTCGCCGCTGGTATCTCCATGGTCACTTCCTTGGCTTTAGCTATCTCTTTCCCTACCCTTGCCGCCGCTCCA
CATATGTTCATCAATGCATACAAGAATGCATTGGCTATCGCAGTTGCCACTGAGTACACTTTCCCACAAGCAGAGAAGGT
CAAGGAGTTTTTGAAGGATCCTAGCAAGTTTGCTGTTGCTGTAGCGGCTGTGTCTGCTGATGCAGGTGGTGGTGCTTCCG
CTGGAGCTGCCAAGGTAGAGGAGAAGAAGGAAGTGGTTGAGGAATCAGATGAAGAAGACTACGGTGGTTTTGACATGTTC
GGTGATGAATAG