Details for Chinese cabbage Locus Brara.E03101

Position : A05 ( 5`- 25620183 .. 25627369 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03101

Protein [Map View]
MEGVRVSLACALLLFVVSSIASAAIVEHTFNVQNLTISRLCKRQVITVVNGSLPGPTVRVKEGDSLVIHVINNSPHNITI
HWHGIFHRLTVWADGPSMITQCPIQPGHRYAYRFNITGQEGTLWWHAHSSFLRATVYGAIIIRPKPGHSYPFPKPHKEVP
IIFGEWWNTDVVALEEAAIATGVPPNNSDAYTINGLPGNLYPCSKDRMFNLDVVKGKLYLLRIINAAMNMQLFFKIANHK
LTVVAADAVYTKPYLTDVIVIAPGQTVDALLHADQSIGSSYYMAAHPYASAPSVPFPNTTTRGVIHYIGGASKTRKTKRV
LMPKLPSFFDTPTAHRFYSNLTSLVHGPHWVPVPRHVDEEMLVTIGLGLEACAGCPNSKFAASMNNHSFVLPKKLSILEA
VFHGVEGIFTPDFPNQPPVKFDYTDPNITQTSPGLLFVHKSTSAKVLKFNTTVDLVLQNHALLAAESHPMHLHGFNFHVL
AQGFGNYDPTRDRSKYNLVNPQFRNTLAVPVGGWAVIRFRADNPGAWIMHCHIDVHLPFGLGMVFVVENGPTKSTSLPPP
PPDLPRC*

DNA
ATGGAGGGCGTTAGGGTTTCTCTTGCTTGCGCTCTTCTTCTTTTTGTAGTCTCTTCAATAGCTTCTGCAGCCATTGTCGA
ACACACCTTCAACGTACAAAACTTAACCATCTCTCGGCTGTGCAAACGGCAAGTGATAACGGTTGTTAATGGAAGCCTGC
CTGGACCAACGGTACGCGTCAAGGAGGGTGACTCGCTCGTTATACACGTCATTAACAATTCCCCTCACAACATCACAATT
CATTGGCACGGGATATTCCATAGACTGACGGTTTGGGCGGATGGGCCGAGCATGATAACGCAATGCCCAATCCAGCCTGG
CCATCGCTACGCTTACAGGTTCAACATCACAGGCCAAGAAGGTACCTTGTGGTGGCACGCACATTCGTCTTTCTTACGCG
CCACCGTATACGGTGCTATCATCATCCGCCCTAAACCCGGTCACTCTTACCCGTTTCCCAAACCCCACAAAGAAGTTCCC
ATCATATTCGGTGAATGGTGGAACACCGACGTAGTCGCGTTAGAAGAGGCTGCTATCGCCACCGGAGTTCCTCCAAACAA
TTCCGACGCCTATACGATCAATGGTCTGCCGGGAAACCTATATCCATGTTCCAAAGACAGAATGTTTAACCTAGACGTGG
TAAAAGGAAAGTTATATTTACTCCGCATCATAAACGCGGCAATGAACATGCAACTGTTTTTCAAGATAGCCAATCACAAG
CTGACAGTTGTCGCAGCCGACGCAGTCTACACCAAACCTTACCTCACCGACGTCATCGTCATCGCACCGGGTCAAACAGT
CGACGCGCTGCTCCACGCCGATCAGTCCATCGGCTCCTCCTACTACATGGCGGCTCACCCTTACGCCAGCGCACCCAGCG
TGCCATTCCCCAACACAACCACCAGAGGCGTCATCCACTACATCGGCGGCGCGTCGAAAACACGCAAAACGAAGCGCGTG
TTGATGCCGAAGCTGCCTTCTTTCTTCGACACGCCAACTGCTCACAGGTTCTACTCTAATCTGACCAGTTTGGTCCATGG
ACCACACTGGGTCCCAGTGCCTCGCCACGTGGACGAGGAGATGCTCGTAACCATCGGGCTCGGGCTAGAGGCTTGCGCTG
GATGTCCGAATTCGAAATTCGCTGCTTCGATGAACAACCACTCCTTCGTCTTACCCAAAAAGCTATCCATCTTGGAAGCG
GTTTTTCACGGCGTCGAAGGCATTTTCACGCCTGATTTTCCAAACCAGCCTCCGGTTAAGTTCGATTACACTGACCCGAA
CATAACCCAGACAAGCCCGGGGCTCTTGTTCGTTCACAAATCAACGAGCGCTAAGGTCTTGAAATTCAATACGACGGTGG
ATTTGGTTCTGCAGAACCACGCGCTTCTCGCGGCTGAGAGTCACCCCATGCATCTCCACGGGTTTAACTTCCACGTGTTG
GCTCAAGGGTTCGGTAATTATGACCCGACCCGTGATCGGAGCAAGTACAATCTTGTTAACCCCCAGTTCCGTAACACCTT
GGCTGTGCCTGTTGGTGGGTGGGCCGTGATCCGTTTCAGAGCGGATAACCCAGGTGCGTGGATTATGCATTGTCATATCG
ATGTTCACTTGCCATTTGGATTAGGGATGGTATTTGTGGTTGAGAACGGACCAACGAAGTCGACCAGCTTGCCACCGCCA
CCTCCTGATCTTCCGAGATGTTAA