Details for Chinese cabbage Locus Brara.E03098

Position : A05 ( 5`- 25567451 .. 25570271 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03098

Protein [Map View]
MAPNDPKNGGGFFASLASSISNLGSAMTKSVNGLVGYEGLEVINPEGSTEDAAEEANRGRWKQEDRDGYWKMMQKYIGSD
VTSMVTLPVIIFEPMTMLQKMAELMEYSHLLDMADQTEDPYMRMVYASSWAISVYYAFQRTWKPFNPILGETYEMANYNG
VNFISEQVSHHPPMSAGHAENEHFTYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFGRTWVD
SPGEMIMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYNASEEPKILMTGKWNESMSYQQCDGEGEPLPGTELKEVWKLA
DVPKDDKYQYTHFAHKINSFDTAPKKLLPSDSRLRPDRYALEMGDMSKSGNEKSSLEERQRAEKRTREEKGQSFTPKWFD
ITEEVTPTPWGDLEVYQFNGKYSEHREAADSSEDNTDPKSIQFNPWQFQDLSTQ*

DNA
ATGGCTCCCAACGATCCTAAAAACGGCGGCGGGTTCTTCGCGTCTCTTGCTTCCTCGATCTCCAATTTGGGATCGGCCAT
GACCAAATCAGTTAACGGTTTGGTTGGCTATGAGGGACTTGAAGTTATTAACCCTGAAGGAAGTACAGAAGATGCTGCTG
AGGAAGCAAACAGAGGAAGGTGGAAGCAAGAGGATCGAGATGGTTATTGGAAGATGATGCAGAAGTACATAGGATCTGAT
GTCACATCAATGGTGACACTGCCTGTGATTATCTTTGAACCAATGACAATGCTCCAGAAAATGGCTGAGTTGATGGAATA
CTCGCATCTATTAGACATGGCAGACCAAACGGAAGACCCTTATATGCGCATGGTGTATGCGTCATCATGGGCAATATCTG
TGTACTATGCTTTCCAACGTACCTGGAAACCGTTCAATCCAATCCTTGGAGAGACTTATGAGATGGCTAATTACAATGGT
GTTAACTTCATCTCTGAACAGGTCAGCCATCATCCGCCAATGAGCGCTGGTCATGCTGAAAATGAGCATTTCACTTATGA
CTGTACATCAAAACTGAAAACAAAGTTTCTAGGCAATTCCATTGACGTCTACCCAGTAGGAAGGACACGAGTGACACTTA
AAAGAGATGGAGTGGTTCTTGACTTGGTACCTCCTCTAACCAAAGTTCACAACCTAATCTTTGGACGAACTTGGGTGGAT
TCTCCTGGGGAAATGATCATGACTAACCTGACCACAGGTGACAAAGTCGTGCTTTACTTCCAACCATGTGGCTGGTTCGG
ATCTGGTCGATATGAAGTGGACGGATATGTCTACAACGCCTCTGAGGAGCCCAAGATTCTCATGACCGGTAAATGGAACG
AGTCCATGAGTTATCAGCAGTGTGACGGTGAAGGTGAACCTCTCCCTGGCACCGAACTGAAGGAGGTCTGGAAACTCGCT
GATGTTCCAAAGGATGACAAGTACCAATACACACACTTTGCTCACAAGATCAACAGCTTTGACACTGCTCCGAAAAAGCT
GTTGCCGTCTGATTCACGGTTACGCCCTGACAGATACGCGCTAGAGATGGGCGACATGTCCAAATCCGGTAATGAGAAGA
GCAGCTTGGAAGAGAGGCAGAGAGCTGAAAAGAGAACTCGCGAAGAGAAAGGTCAAAGCTTTACTCCCAAGTGGTTTGAT
ATAACTGAAGAAGTCACTCCTACACCATGGGGGGATCTTGAAGTTTATCAATTCAACGGAAAGTACTCAGAACATAGGGA
AGCTGCGGATAGCTCTGAAGATAACACCGACCCTAAGTCAATCCAGTTCAACCCATGGCAATTTCAAGATTTGTCTACTC
AATGA