Details for Chinese cabbage Locus Brara.E03097

Position : A05 ( 5`- 25566995 .. 25568062 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03097

Protein [Map View]
MAVVVSVHRLSATHLISENSKPPKLHLKFNTPRLSFHHFPQTNKHQLRCLSAKSTPSSPDPDSPQDGEEQESVGVKAALA
MLRFYKREISPVLPRSCRYVPTCSEYSMEAYKKYGVLKGTVLTTWRLCRCNPLGGSGFDPPRWFGESVITPQAEEEEDSY
SNEDEREI*

DNA
ATGGCAGTCGTCGTCTCCGTTCATCGTCTTTCCGCAACCCACTTGATCTCTGAAAACTCTAAACCTCCTAAACTTCACTT
GAAATTCAATACGCCTCGCCTGAGCTTTCATCATTTTCCTCAGACAAACAAGCACCAGCTCCGTTGCTTATCTGCGAAAT
CGACACCTTCGAGTCCAGACCCTGACTCTCCTCAAGATGGTGAAGAGCAGGAGAGTGTGGGAGTCAAAGCAGCTTTAGCA
ATGCTGAGATTCTACAAGAGGGAGATATCGCCGGTGTTACCTAGAAGCTGCCGTTACGTTCCAACTTGCAGCGAGTACTC
TATGGAAGCTTACAAAAAATATGGAGTTCTCAAAGGCACTGTTCTCACCACTTGGCGTCTCTGCCGCTGCAATCCTCTTG
GTGGATCTGGATTCGATCCTCCAAGATGGTTTGGTGAGAGTGTGATCACTCCCCAGGCAGAAGAAGAAGAAGATAGCTAT
AGCAATGAGGATGAAAGAGAGATTTGA